Active Recombinant Human ADIPOQ Protein (227 aa)

• Cat.No.: ADIPOQ-444A
• Product Overview: Recombinant human Adiponectin (rhAdiponectin) produced in E. coli is a single non-glycosylated polypeptide chain containing 227 amino acids. A fully biologically active molecule, rhAdiponectin has a molecular mass of 24.7 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 227
• Description: Adiponectin is a hormone mainly produced by adipocytes. Adiponectin forms a homotrimer and exists as higher order multimers in vivo. The receptors of Adiponectin are seven-transmembrane G protein coupled receptors: Receptor 1 is expressed in skeletal muscle and Receptor 2 in liver. Adiponectin receives a lot of attention because of its anti-diabetic, anti-atherosclerotic, and anti-inflammatory properties. Adiponectin increases the expression of molecules involved in fatty acid transport, combustion of fatty acid, and energy dissipation, and increases insulin sensitivity of the body. Decreased levels of Adiponectin are associated with hypertension, cardiovascular diseases, and metabolic syndromes. Therefore, Adiponectin has promising potential as a pharmacological agent.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 μg/mL, measured by a cell growth inhibitory assay using M1 cells, corresponding to a specific activity of > 2 × 10^2 units/mg.
• Molecular Mass: 24.7 kDa, observed by reducing SDS-PAGE.
• AA Sequence: METTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human Adiponectin (rhAdiponectin) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhAdiponectin remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50 mM Tris, 150 mM NaCl, pH8.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ]
• Official Symbol: ADIPOQ
• Synonyms: ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1
• Gene ID: 9370
• mRNA Refseq: NM_001177800
• Protein Refseq: NP_001171271
• MIM: 605441
• UniProt ID: Q15848