Active Recombinant Human AKR1B1 Protein, His tagged
| Cat.No. : | AKR1B1-9156H |
| Product Overview : | Active Recombinant Human AKR1B1 Protein with His tag was expressed in E. coli. |
| Availability | July 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-316 aa |
| Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. |
| AASequence : | MHHHHHHHHDYKDDDDKMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF |
| Molecular Mass : | 38 kDa |
| Bio-activity : | Specific activity: 1.2 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH/min at 25 centigrade. Specific activity was expressed in units/mg of protein. |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile 20mM Tris, 1mM DTT, 10% Glycerol, pH8.0 |
| Concentration : | 1 mg/mL by Bradford |
| Gene Name | AKR1B1 aldo-keto reductase family 1, member B1 (aldose reductase) [ Homo sapiens (human) ] |
| Official Symbol | AKR1B1 |
| Synonyms | AKR1B1; aldo-keto reductase family 1, member B1 (aldose reductase); ALDR1; aldose reductase; AR; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1; ADR; ALR2; MGC1804 |
| Gene ID | 231 |
| mRNA Refseq | NM_001628 |
| Protein Refseq | NP_001619 |
| MIM | 103880 |
| UniProt ID | P15121 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1B1 Products
Required fields are marked with *
My Review for All AKR1B1 Products
Required fields are marked with *
