Active Recombinant Human AKR1B1 Protein, His tagged

Cat.No. : AKR1B1-9156H
Product Overview : Active Recombinant Human AKR1B1 Protein with His tag was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-316 aa
Description : This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database.
AASequence : MHHHHHHHHDYKDDDDKMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Molecular Mass : 38 kDa
Bio-activity : Specific activity: 1.2 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH/min at 25 centigrade. Specific activity was expressed in units/mg of protein.
Endotoxin : < 1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile 20mM Tris, 1mM DTT, 10% Glycerol, pH8.0
Concentration : 1 mg/mL by Bradford
Gene Name AKR1B1 aldo-keto reductase family 1, member B1 (aldose reductase) [ Homo sapiens (human) ]
Official Symbol AKR1B1
Synonyms AKR1B1; aldo-keto reductase family 1, member B1 (aldose reductase); ALDR1; aldose reductase; AR; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1; ADR; ALR2; MGC1804
Gene ID 231
mRNA Refseq NM_001628
Protein Refseq NP_001619
MIM 103880
UniProt ID P15121

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKR1B1 Products

Required fields are marked with *

My Review for All AKR1B1 Products

Required fields are marked with *

0
cart-icon
0
compare icon