Active Recombinant Human AMHR2, Fc-tagged, Biotinylated
Cat.No. : | AMHR2-535H |
Product Overview : | The recombinant human AMHR2-Fc fusion protein is expressed as a 354 amino acid protein consisting of Pro18 - Ser144 region of AMHR2 (UniProt accession #Q16671) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 18-144 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Recombinant AMHR2 protein binds human AMH/MIS and blocks AMH/MIS-induced signaling activity |
Molecular Mass : | Calculated molecular mass (kDa): 39.0; Estimated by SDS-PAGE under reducing condition (kDa): 50-55 |
AA Sequence : | PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLH CDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGESTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | AMHR2 anti-Mullerian hormone receptor, type II [ Homo sapiens ] |
Official Symbol | AMHR2 |
Synonyms | AMHR2; anti-Mullerian hormone receptor, type II; anti-Muellerian hormone type-2 receptor; MISR2; MISRII; M?llerian inhibiting substance type II receptor; AMH type II receptor; MIS type II receptor; anti-Muellerian hormone type II receptor; Mullerian inhibiting substance type II receptor; AMHR; MRII; |
Gene ID | 269 |
mRNA Refseq | NM_001164690 |
Protein Refseq | NP_001158162 |
MIM | 600956 |
UniProt ID | Q16671 |
Chromosome Location | 12q13 |
Pathway | ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | ATP binding; hormone binding; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta receptor activity, type II; |
◆ Recombinant Proteins | ||
AMHR2-5601H | Active Recombinant Human Anti-Mullerian Hormone Receptor, Type II, Fc-tagged | +Inquiry |
Amhr2-01R | Active Recombinant Rat Amhr2 Protein, Fc-tagged | +Inquiry |
AMHR2-050H | Recombinant Human AMHR2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
Amhr2-552R | Recombinant Rat Anti-Mullerian Hormone Receptor, Type II, Fc-tagged | +Inquiry |
AMHR2-0488H | Recombinant Human AMHR2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AMHR2-651R | Recombinant Rat AMHR2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMHR2-8883HCL | Recombinant Human AMHR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMHR2 Products
Required fields are marked with *
My Review for All AMHR2 Products
Required fields are marked with *