| Species : |
Human |
| Source : |
Insect Cells |
| Tag : |
His |
| Protein Length : |
63-303aa |
| Description : |
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. |
| Form : |
Liquid |
| Bio-activity : |
> 3,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of Adenosine 5-triphosphate to phosphate per minute per minute at pH 7.5 at 25 centigrade. |
| Molecular Mass : |
29 kDa (250aa) |
| AA Sequence : |
EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |