Active Recombinant Human ATP1B1 Protein (63-303aa), C-His tagged
Cat.No. : | ATP1B1-17H |
Product Overview : | Recombinant human ATP1B1 protein (63-303aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 63-303aa |
Description : | The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. |
Form : | Liquid |
Bio-activity : | > 3,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of Adenosine 5-triphosphate to phosphate per minute per minute at pH 7.5 at 25 centigrade. |
Molecular Mass : | 29 kDa (250aa) |
AA Sequence : | EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Enzyme Activity |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | ATP1B1 ATPase Na+/K+ transporting subunit beta 1 [ Homo sapiens (human) ] |
Official Symbol | ATP1B1 |
Synonyms | ATP1B1; ATPase Na+/K+ transporting subunit beta 1; ATP1B; sodium/potassium-transporting ATPase subunit beta-1; ATPase, Na+/K+ transporting, beta 1 polypeptide; Beta 1-subunit of Na(+),K(+)-ATPase; Na, K-ATPase beta-1 polypeptide; adenosinetriphosphatase; sodium pump subunit beta-1; sodium-potassium ATPase subunit beta 1 (non-catalytic); sodium/potassium-dependent ATPase beta-1 subunit; sodium/potassium-transporting ATPase beta-1 chain; EC 3.6.1.3 |
Gene ID | 481 |
mRNA Refseq | NM_001677 |
Protein Refseq | NP_001668 |
MIM | 182330 |
UniProt ID | P05026 |
◆ Recombinant Proteins | ||
ATP1B1-2550H | Recombinant Human ATP1B1 protein(101-170 aa), C-His-tagged | +Inquiry |
ATP1B1-321C | Recombinant Cynomolgus ATP1B1 Protein, His-tagged | +Inquiry |
RFL-1006MF | Recombinant Full Length Mouse Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged | +Inquiry |
ATP1B1-1131HF | Recombinant Full Length Human ATP1B1 Protein, GST-tagged | +Inquiry |
ATP1b1-3766M | Recombinant Mouse ATP1b1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP1B1 Products
Required fields are marked with *
My Review for All ATP1B1 Products
Required fields are marked with *
0
Inquiry Basket