Active Recombinant Human BDNF Protein

Cat.No. : BDNF-04H
Product Overview : Recombinant Human BDNF Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Brain-derived neurotrophic factor (BDNF) is a nerve growth factor that binds two receptors, the low-affinity nerve growth factor receptor (LNGFR) and the tropomyosin receptor kinase B (TrkB), to support neuron growth and survival. BDNF expression in the hippocampus is essential for long-term memory storage and learning. Human, mouse, rat, and pig BDNF are cross-reactive.
Bio-activity : C6 cell proliferation, ≤2 μg/mL; ≥5.0 x 102 units/mg
Molecular Mass : Noncovalent Homodimer, 13.6/27.3 kDa (120/240 aa)
AA Sequence : MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name BDNF brain-derived neurotrophic factor [ Homo sapiens (human) ]
Official Symbol BDNF
Synonyms BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632;
Gene ID 627
mRNA Refseq NM_001143805
Protein Refseq NP_001137277
MIM 113505
UniProt ID P23560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BDNF Products

Required fields are marked with *

My Review for All BDNF Products

Required fields are marked with *

0
cart-icon
0
compare icon