Species : |
Human |
Source : |
CHO |
Description : |
BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50< 4 μg/mL, measured in a bioassay using C6 cells. |
Molecular Mass : |
12-14kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant human BDNF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human BDNF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |