Active Recombinant Human BMPR1A, Fc-tagged
Cat.No. : | BMPR1A-554H |
Product Overview : | The recombinant human BMPR1A-Fc fusion protein is expressed as a 354 amino acid protein consisting of Gln24 - Ser150 region of BMPR1A (UniProt accession #P36894) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 24-150 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Recombinant BMPR1A protein binds human BMP2 and BMP4, and blocks BMP2/BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells). |
Molecular Mass : | Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 50-55 |
AA Sequence : | QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLA SGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | BMPR1A bone morphogenetic protein receptor, type IA [ Homo sapiens ] |
Official Symbol | BMPR1A |
Synonyms | BMPR1A; bone morphogenetic protein receptor, type IA; ACVRLK3; bone morphogenetic protein receptor type-1A; ALK3; CD292; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5; SKR5; 10q23del; |
Gene ID | 657 |
mRNA Refseq | NM_004329 |
Protein Refseq | NP_004320 |
MIM | 601299 |
UniProt ID | P36894 |
Chromosome Location | 10q22.3 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; Heart Development, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; |
Function | ATP binding; SMAD binding; activin receptor activity, type II; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
BMPR1A-3748HF | Recombinant Full Length Human BMPR1A Protein | +Inquiry |
BMPR1A-2932H | Recombinant Human BMPR1A protein, His-tagged | +Inquiry |
BMPR1A-169H | Recombinant Human BMPR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
BMPR1A-160H | Recombinant Human BMPR1A, His-tagged | +Inquiry |
BMPR1A-354H | Recombinant Human BMPR1A protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMPR1A-2466MCL | Recombinant Mouse BMPR1A cell lysate | +Inquiry |
BMPR1A-2145HCL | Recombinant Human BMPR1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPR1A Products
Required fields are marked with *
My Review for All BMPR1A Products
Required fields are marked with *