Active Recombinant Human CADM1, Fc-tagged
Cat.No. : | CADM1-647H |
Product Overview : | The recombinant human NECL2-Fc fusion protein is expressed as a 531-amino acid protein consisting of Gln451 - His346 region of NECL2 (UniProt accession #Q9BY67 - isoform 5) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 451-346 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized NECL2 binds CRTAM/CD355 in a functional ELISA |
Molecular Mass : | Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 70-80 |
AA Sequence : | QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISD EGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEV EEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELT CEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGS IRAVDHGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CADM1 cell adhesion molecule 1 [ Homo sapiens ] |
Official Symbol | CADM1 |
Synonyms | CADM1; cell adhesion molecule 1; IGSF4, immunoglobulin superfamily, member 4 , TSLC1, tumor suppressor in lung cancer 1; BL2; IGSF4A; Necl 2; NECL2; nectin like 2; RA175; ST17; SYNCAM; SYNCAM1; TSLC-1; nectin-like 2; nectin-like protein 2; truncated CADM1 protein; TSLC1/Nectin-like 2/IGSF4; synaptic cell adhesion molecule; tumor suppressor in lung cancer 1; immunoglobulin superfamily member 4; immunoglobulin superfamily, member 4; spermatogenic immunoglobulin superfamily; immunoglobulin superfamily, member 4D variant 2; IGSF4; TSLC1; Necl-2; sgIGSF; sTSLC-1; synCAM1; MGC51880; MGC149785; DKFZp686F1789; |
Gene ID | 23705 |
mRNA Refseq | NM_001098517 |
Protein Refseq | NP_001091987 |
MIM | 605686 |
UniProt ID | Q9BY67 |
Chromosome Location | 11q23.2 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Nectin/Necltrans heterodimerization, organism-specific biosystem; |
Function | PDZ domain binding; protein C-terminus binding; protein homodimerization activity; receptor binding; receptor binding; |
◆ Recombinant Proteins | ||
CADM1-112H | Recombinant Human CADM1 Protein, His-tagged | +Inquiry |
CADM1-2260H | Recombinant Human CADM1 Protein, MYC/DDK-tagged | +Inquiry |
Cadm1-5604M | Active Recombinant Mouse Cell Adhesion Molecule 1, His-tagged | +Inquiry |
CADM1-1182M | Recombinant Mouse CADM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CADM1-0282H | Recombinant Human CADM1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CADM1-2527HCL | Recombinant Human CADM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CADM1 Products
Required fields are marked with *
My Review for All CADM1 Products
Required fields are marked with *