Recombinant Human CADM1 protein, His-tagged
| Cat.No. : | CADM1-35H |
| Product Overview : | Recombinant Human CADM1 protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Enables signaling receptor binding activity. Involved in several processes, including cell recognition; positive regulation of cytokine production; and susceptibility to natural killer cell mediated cytotoxicity. Located in plasma membrane. Implicated in breast carcinoma and prostate cancer. Biomarker of cervix uteri carcinoma in situ. |
| Form : | PBS, pH 7.4. |
| Molecular Mass : | 35.35 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPP |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Gene Name | CADM1 cell adhesion molecule 1 [ Homo sapiens (human) ] |
| Official Symbol | CADM1 |
| Gene ID | 23705 |
| mRNA Refseq | NM_014333 |
| Protein Refseq | NP_055148 |
| MIM | 605686 |
| UniProt ID | Q9BY67 |
| ◆ Recombinant Proteins | ||
| CADM1-484H | Recombinant Human CADM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cadm1-1931M | Recombinant Mouse Cadm1 Protein, Myc/DDK-tagged | +Inquiry |
| CADM1-1223H | Recombinant Human CADM1 protein, His & GST-tagged | +Inquiry |
| CADM1-2635M | Recombinant Mouse CADM1 Protein | +Inquiry |
| Cadm1-10651m | Recombinant mouse Cadm1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CADM1-2527HCL | Recombinant Human CADM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CADM1 Products
Required fields are marked with *
My Review for All CADM1 Products
Required fields are marked with *



