Recombinant Human CADM1 protein, His-tagged

Cat.No. : CADM1-35H
Product Overview : Recombinant Human CADM1 protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Enables signaling receptor binding activity. Involved in several processes, including cell recognition; positive regulation of cytokine production; and susceptibility to natural killer cell mediated cytotoxicity. Located in plasma membrane. Implicated in breast carcinoma and prostate cancer. Biomarker of cervix uteri carcinoma in situ.
Form : PBS, pH 7.4.
Molecular Mass : 35.35 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPP
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name CADM1 cell adhesion molecule 1 [ Homo sapiens (human) ]
Official Symbol CADM1
Gene ID 23705
mRNA Refseq NM_014333
Protein Refseq NP_055148
MIM 605686
UniProt ID Q9BY67

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CADM1 Products

Required fields are marked with *

My Review for All CADM1 Products

Required fields are marked with *

0
cart-icon
0
compare icon