Recombinant Human CADM1 protein, His-tagged
Cat.No. : | CADM1-35H |
Product Overview : | Recombinant Human CADM1 protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Enables signaling receptor binding activity. Involved in several processes, including cell recognition; positive regulation of cytokine production; and susceptibility to natural killer cell mediated cytotoxicity. Located in plasma membrane. Implicated in breast carcinoma and prostate cancer. Biomarker of cervix uteri carcinoma in situ. |
Form : | PBS, pH 7.4. |
Molecular Mass : | 35.35 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPP |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Gene Name | CADM1 cell adhesion molecule 1 [ Homo sapiens (human) ] |
Official Symbol | CADM1 |
Gene ID | 23705 |
mRNA Refseq | NM_014333 |
Protein Refseq | NP_055148 |
MIM | 605686 |
UniProt ID | Q9BY67 |
◆ Recombinant Proteins | ||
CADM1-2635M | Recombinant Mouse CADM1 Protein | +Inquiry |
CADM1-428H | Recombinant Human CADM1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cadm1-712M | Recombinant Mouse Cadm1 protein, His-tagged | +Inquiry |
Cadm1-1180M | Recombinant Mouse Cadm1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cadm1-5942M | Recombinant Mouse Cadm1 Protein (Gln48-His388), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CADM1-2527HCL | Recombinant Human CADM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CADM1 Products
Required fields are marked with *
My Review for All CADM1 Products
Required fields are marked with *
0
Inquiry Basket