Active Recombinant Human CADM2, Fc-tagged, Biotinylated
Cat.No. : | CADM2-648H |
Product Overview : | The recombinant human NECL3-Fc fusion protein is expressed as a 572-amino acid protein consisting of Gln25 - His367 region of NECL3 (UniProt accession #Q8N3J6) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 25-367 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Enhances neurite outgrowth of E16-E18 rat embryonic cortical neurons |
Molecular Mass : | Calculated molecular mass (kDa): 63.2; Estimated by SDS-PAGE under reducing condition (kDa): 80-65 |
AA Sequence : | QFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSD EGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYL KEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLIL TCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTL LPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALAGQNGPDHGSTGTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | CADM2 cell adhesion molecule 2 [ Homo sapiens ] |
Official Symbol | CADM2 |
Synonyms | CADM2; cell adhesion molecule 2; IGSF4D, immunoglobulin superfamily, member 4D; Necl 3; NECL3; nectin like 3; SynCAM2; nectin-like 3; nectin-like protein 3; immunoglobulin superfamily member 4D; immunoglobulin superfamily, member 4D; IGSF4D; Necl-3; synCAM2; MGC104534; MGC138341; MGC138343; |
Gene ID | 253559 |
mRNA Refseq | NM_001167674 |
Protein Refseq | NP_001161146 |
MIM | 609938 |
UniProt ID | Q8N3J6 |
Chromosome Location | 3p12.2 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
◆ Recombinant Proteins | ||
CADM2-2583H | Recombinant Human CADM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CADM2-354H | Recombinant Human CADM2 Protein, His-tagged | +Inquiry |
CADM2-714H | Recombinant Human CADM2 Protein, His-tagged | +Inquiry |
CADM2-648H | Active Recombinant Human CADM2, Fc-tagged, Biotinylated | +Inquiry |
CADM2-744R | Recombinant Rat CADM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CADM2 Products
Required fields are marked with *
My Review for All CADM2 Products
Required fields are marked with *