Active Recombinant Human CCL22 Protein (68 aa)

Name: Active Recombinant Human CCL22 Protein (68 aa)
SKU: CCL22-082C

Species :	Human
Source :	E.coli
Protein Length :	68
Description :	MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells and exerts HIV suppressive activity.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/mL.
Molecular Mass :	8.0 kDa, a single, non-glycosylated polypeptide chain containing 68 amino acids.
AA Sequence :	GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLS
Endotoxin :	Less than 1 EU/mg of rHuMDC/CCL22 as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analyses.
Storage :	This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer :	Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 500mM NaCl.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Name	CCL22 chemokine (C-C motif) ligand 22 [ Homo sapiens ]
Official Symbol	CCL22
Synonyms	CCL22; chemokine (C-C motif) ligand 22; SCYA22, small inducible cytokine subfamily A (Cys Cys), member 22; C-C motif chemokine 22; A 152E5.1; ABCD 1; DC/B CK; MDC; MGC34554; STCP 1; MDC(1-69); CC chemokine STCP-1; macrophage-derived chemokine; small inducible cytokine A22; small-inducible cytokine A22; stimulated T cell chemotactic protein 1; stimulated T-cell chemotactic protein 1; small inducible cytokine subfamily A (Cys-Cys), member 22; ABCD-1; SCYA22; STCP-1; DC/B-CK; A-152E5.1;
Gene ID	6367
mRNA Refseq	NM_002990
Protein Refseq	NP_002981
MIM	602957
UniProt ID	O00626