| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
68 |
| Description : |
MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells and exerts HIV suppressive activity. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/mL. |
| Molecular Mass : |
8.0 kDa, a single, non-glycosylated polypeptide chain containing 68 amino acids. |
| AA Sequence : |
GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLS |
| Endotoxin : |
Less than 1 EU/mg of rHuMDC/CCL22 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 500mM NaCl. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |