Active Recombinant Human CCL28 Protein (108 aa)

Cat.No. : CCL28-077C
Product Overview : Recombinant Human CCL28 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 108
Description : Human CCL28 (CC chemokine ligand 28) is a novel CC chemokine identified by TBLASTN searches of the Human Genome Systems (HGS) and Genbank dbEst database using a human chemokine consensus sequence. Human CCL28 cDNA encodes a 127 amino acid (aa) residue precursor protein with a putative 22 aa residue signal peptide that is cleaved to produce the 105 aa residue mature protein. Human and mouse CCL28 are highly conserved, sharing 83% aa identity in their mature regions. Among CC chemokines, CCL28 shares the most homology with CCL27/CTACK. The mouse CCL28 gene has been mapped to the distal region of chromosome 13. Human and mouse CCL28 RNA expression was found to be highest in normal and pathologic colon with the protein being expressed by epithelial cells. Human CCL28 RNA was also present in normal and asthmatic lung tissues. The receptor for CCL28 has been identified as the CCR10 (GPR2 orphan receptor) which is also the receptor for CCL27/CTACK.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. Determined by its ability to chemoattract human lymphocytes using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg.
Molecular Mass : 12.3 kDa, a single non-glycosylated polypeptide chain containing 108 amino acids.
AA Sequence : SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Endotoxin : Less than 1 EU/mg of rHuMEC/CCL28 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL28 chemokine (C-C motif) ligand 28 [ Homo sapiens ]
Official Symbol CCL28
Synonyms CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902;
Gene ID 56477
mRNA Refseq NM_148672
Protein Refseq NP_683513
MIM 605240
UniProt ID Q9NRJ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL28 Products

Required fields are marked with *

My Review for All CCL28 Products

Required fields are marked with *

0
cart-icon