Active Recombinant Human CCL3 Protein
| Cat.No. : | CCL3-0636H |
| Product Overview : | Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 24-92 a.a. |
| Description : | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010] |
| Form : | Lyophlized |
| Bio-activity : | Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/mL. |
| Molecular Mass : | 8 kDa |
| AA Sequence : | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Endotoxin : | < 0.1 ng/μg (1 EU/μg) |
| Purity : | > 90% by SDS-PAGE and HPLC |
| Applications : | Functional Study SDS-PAGE |
| Storage : | Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | Lyophlized from PBS, pH 7.5 |
| Gene Name | CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ] |
| Official Symbol | CCL3 |
| Synonyms | CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha; |
| Gene ID | 6348 |
| mRNA Refseq | NM_002983 |
| Protein Refseq | NP_002974 |
| MIM | 182283 |
| UniProt ID | P10147 |
| ◆ Recombinant Proteins | ||
| MIP1a-3329M | Active Recombinant Mouse CCL3 protein, His-tagged | +Inquiry |
| Ccl3-2977M | Recombinant Mouse Ccl3 Protein | +Inquiry |
| CCL3-1396M | Recombinant Mouse CCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCL3-1490H | Recombinant Human CCL3 Protein (Ala27-Ala92), N-GST tagged | +Inquiry |
| CCL3-2975M | Recombinant Mouse CCL3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *



