Active Recombinant Human CCL3 Protein

Cat.No. : CCL3-0636H
Product Overview : Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 24-92 a.a.
Description : This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]
Form : Lyophlized
Bio-activity : Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/mL.
Molecular Mass : 8 kDa
AA Sequence : SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Endotoxin : < 0.1 ng/μg (1 EU/μg)
Purity : > 90% by SDS-PAGE and HPLC
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophlized from PBS, pH 7.5
Gene Name CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ]
Official Symbol CCL3
Synonyms CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha;
Gene ID 6348
mRNA Refseq NM_002983
Protein Refseq NP_002974
MIM 182283
UniProt ID P10147

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL3 Products

Required fields are marked with *

My Review for All CCL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon