| Species : |
Human |
| Source : |
CHO |
| Description : |
Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 5 μg/mL, measured in a cell proliferation assay using 3T3 cells. |
| Molecular Mass : |
20-50 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : |
Lyophilized recombinant Human NOV remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |
