Active Recombinant Human CCN3 Protein

Cat.No. : CCN3-211C
Product Overview : Recombinant Human CCN3 Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 μg/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass : 20-50 kDa, observed by reducing SDS-PAGE.
AA Sequence : TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human NOV remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CCN3 cellular communication network factor 3 [ Homo sapiens (human) ]
Official Symbol CCN3
Synonyms CCN3; cellular communication network factor 3; NOV; NOVh; IBP-9; IGFBP9; IGFBP-9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephro blastoma-overexpressed gene protein homolog; nephroblastoma overexpressed; nephroblastoma-overexpressed gene protein homolog; protein NOV homolog
Gene ID 4856
mRNA Refseq NM_002514
Protein Refseq NP_002505
MIM 164958
UniProt ID P48745

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCN3 Products

Required fields are marked with *

My Review for All CCN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon