Active Recombinant Human CD244, Fc-tagged, Biotinylated
Cat.No. : | CD244-684H |
Product Overview : | he recombinant human SLAMF4 ECD protein is expressed as a 431-amino acid protein consisting of Cys22 - Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 - isoform 2) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-224 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized SLAMF4 binds heterophilically to SLAMF2/CD48 in a functional ELISA |
Molecular Mass : | Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
AA Sequence : | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIK AAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSK LIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ] |
Official Symbol | CD244 |
Synonyms | CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL; |
Gene ID | 51744 |
mRNA Refseq | NM_001166663 |
Protein Refseq | NP_001160135 |
MIM | 605554 |
UniProt ID | Q9BZW8 |
Chromosome Location | 1q23.1 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
Function | protein binding; receptor activity; |
◆ Recombinant Proteins | ||
CD244-2845H | Active Recombinant Human CD244 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
CD244-1624R | Recombinant Rhesus Monkey CD244 Protein, hIgG4-tagged | +Inquiry |
CD244-113H | Recombinant Human CD244 Protein, C-His-tagged | +Inquiry |
CD244-24H | Recombinant Human CD244 Protein, Fc-His-tagged(C-ter) | +Inquiry |
CD244-2852H | Active Recombinant Human CD244 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD244-2303HCL | Recombinant Human CD244 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD244 Products
Required fields are marked with *
My Review for All CD244 Products
Required fields are marked with *