Active Recombinant Human CD274 protein, His-tagged, biotinylated
| Cat.No. : | CD274-785H |
| Product Overview : | Recombinant Human CD274 Protein (NP_054862.1, 19-238aa), was expressed in HEK293 with C-terminal His tag and biotinylated conjugate (contains 4 potential N-linked glycosylation sites). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-238 aa |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds to its receptor PD-1 extracellular domain proteins and PD-1 molecule on cell surface with low affinity (KD in μM range) and anti-PD-L1 monoclonal antibody with high affinity(KD < 1 nM) as measured by ELISA. |
| Molecular Mass : | Calculated molecular mass 26.5kDa; estimated by SDS-PAGE under reducing condition ~35 kDa with higher molecular mass smear resembling different glycosylation states. |
| AA Sequence : | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLS LGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIW TSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERSTG HHHHHHHH |
| Endotoxin : | <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Conjugation : | Biotin |
| Gene Name | CD274 CD274 molecule [ Homo sapiens ] |
| Official Symbol | CD274 |
| Synonyms | CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296; |
| Gene ID | 29126 |
| mRNA Refseq | NM_014143 |
| Protein Refseq | NP_054862 |
| MIM | 605402 |
| UniProt ID | Q9NZQ7 |
| Chromosome Location | 9p24.1 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem; |
| Function | protein binding; protein tyrosine phosphatase activity; receptor activity; |
| ◆ Cell & Tissue Lysates | ||
| CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
| CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
| CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
| CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
