Active Recombinant Human CD274 protein, His-tagged, biotinylated

• Cat.No.: CD274-785H
• Product Overview: Recombinant Human CD274(Phe19 - Arg238), fused with His tag at C-terminal was expressed in HEK293, Biotinylated, it contains 4 potential sites for N-linked glycosylation.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 19-238 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds to its receptor PD-1 extracellular domain proteins and PD-1 molecule on cell surface with low affinity (KD in μM range) and anti-PD-L1 monoclonal antibody with high affinity(KD < 1 nM) as measured by ELISA.
• Molecular Mass: Calculated molecular mass 26.5kDa; estimated by SDS-PAGE under reducing condition ~35 kDa with higher molecular mass smear resembling different glycosylation states.
• AA Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLS LGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIW TSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERSTG HHHHHHHH
• Endotoxin: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
• Purity: >95% judged by SDS-PAGE under reducing condition
• Conjugation: Biotin

Gene Information

• Gene Name: CD274 CD274 molecule [ Homo sapiens ]
• Official Symbol: CD274
• Synonyms: CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296
• Gene ID: 29126
• mRNA Refseq: NM_014143
• Protein Refseq: NP_054862
• MIM: 605402
• UniProt ID: Q9NZQ7
• Chromosome Location: 9p24.1
• Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem
• Function: protein binding; protein tyrosine phosphatase activity; receptor activity