Active Recombinant Human CD274 protein, His-tagged, biotinylated

Cat.No. : CD274-785H
Product Overview : Recombinant Human CD274(Phe19 - Arg238), fused with His tag at C-terminal was expressed in HEK293, Biotinylated, it contains 4 potential sites for N-linked glycosylation.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 19-238 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to its receptor PD-1 extracellular domain proteins and PD-1 molecule on cell surface with low affinity (KD in μM range) and anti-PD-L1 monoclonal antibody with high affinity(KD < 1 nM) as measured by ELISA.
Molecular Mass : Calculated molecular mass 26.5kDa; estimated by SDS-PAGE under reducing condition ~35 kDa with higher molecular mass smear resembling different glycosylation states.
AA Sequence : FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLS LGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIW TSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERSTG HHHHHHHH
Endotoxin : <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Purity : >95% judged by SDS-PAGE under reducing condition
Gene Name CD274 CD274 molecule [ Homo sapiens ]
Official Symbol CD274
Synonyms CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296;
Gene ID 29126
mRNA Refseq NM_014143
Protein Refseq NP_054862
MIM 605402
UniProt ID Q9NZQ7
Chromosome Location 9p24.1
Pathway Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem;
Function protein binding; protein tyrosine phosphatase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD274 Products

Required fields are marked with *

My Review for All CD274 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon