Active Recombinant Human CD274 protein, His-tagged, biotinylated
Cat.No. : | CD274-785H |
Product Overview : | Recombinant Human CD274(Phe19 - Arg238), fused with His tag at C-terminal was expressed in HEK293, Biotinylated, it contains 4 potential sites for N-linked glycosylation. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-238 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds to its receptor PD-1 extracellular domain proteins and PD-1 molecule on cell surface with low affinity (KD in μM range) and anti-PD-L1 monoclonal antibody with high affinity(KD < 1 nM) as measured by ELISA. |
Molecular Mass : | Calculated molecular mass 26.5kDa; estimated by SDS-PAGE under reducing condition ~35 kDa with higher molecular mass smear resembling different glycosylation states. |
AA Sequence : | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLS LGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIW TSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERSTG HHHHHHHH |
Endotoxin : | <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Gene Name | CD274 CD274 molecule [ Homo sapiens ] |
Official Symbol | CD274 |
Synonyms | CD274; CD274 molecule; CD274 antigen , PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296; |
Gene ID | 29126 |
mRNA Refseq | NM_014143 |
Protein Refseq | NP_054862 |
MIM | 605402 |
UniProt ID | Q9NZQ7 |
Chromosome Location | 9p24.1 |
Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem; |
Function | protein binding; protein tyrosine phosphatase activity; receptor activity; |
◆ Recombinant Proteins | ||
CD274-714M | Recombinant Mouse CD274 Protein, IgG2a Fc-tagged | +Inquiry |
CD274-062H | Active Recombinant Human CD274 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
Cd274-561RAF647 | Recombinant Rat Cd274 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Cd274-26M | Recombinant Mouse CD274 Protein, His-tagged(C-ter) | +Inquiry |
Cd274-7693R | Recombinant Rat Cd274 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
CD274-77M | Active Recombinant Mouse CD274 Protein, Fctagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
0
Inquiry Basket