Active Recombinant Human CD276 Protein, Fc-tagged, Alexa Fluor 555 conjugated

Cat.No. : CD276-542HAF555
Product Overview : The Alexa Fluor 555 conjugated recombinant human B7-H3-Fc fusion is expressed as a 448 amino acid protein consisting of Leu29 - Ala248 region of B7-H3 (UniProt accession #Q5ZPR3 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Availability October 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 29-248 a.a.
Bio-activity : Inhibits anti-CD3-induced proliferation of stimulated human T cells. Binds anti-B7-H3 monoclonal antibodies, human IgG1 and rabbit IgG in a functional ELISA.
Molecular Mass : Calculated molecular mass 49.2 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
AA Sequence : LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ GNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEV FWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEAST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK
Endotoxin : < 0.1 EU/ μg of purified recombinant protein determined by the LAL method
Purity : > 95 % by SDS-PAGE under reducing condition
Characteristic : Disulfide-linked homodimer
Labeled with Alexa Fluor 555 via amines
With an excitation and emission maximum of 555/565 nm, Alexa Fluor 555 can be efficiently excited using a 543 nm He-Ne laser line and detected under standard TRITC/Cy3 filters.
Storage : The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Storage Buffer : Supplied at 0.5 mg/ml in sterile PBS pH 7.4 (carrier free).
Conjugation : Alexa Fluor 555
Gene Name CD276 CD276 molecule [ Homo sapiens ]
Official Symbol CD276
Synonyms CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3;
Gene ID 80381
mRNA Refseq NM_001024736
Protein Refseq NP_001019907
MIM 605715
UniProt ID Q5ZPR3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD276 Products

Required fields are marked with *

My Review for All CD276 Products

Required fields are marked with *

0
cart-icon
0
compare icon