Active Recombinant Human CD276 Protein, Fc-tagged, FITC conjugated
| Cat.No. : | CD276-542HF |
| Product Overview : | The FITC conjugated recombinant human B7-H3-Fc fusion is expressed as a 448 amino acid protein consisting of Leu29 - Ala248 region of B7-H3 (UniProt accession #Q5ZPR3 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
| Availability | November 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 29-248 a.a. |
| Bio-activity : | Inhibits anti-CD3-induced proliferation of stimulated human T cells. Binds anti-B7-H3 monoclonal antibodies, human IgG1 and rabbit IgG in a functional ELISA. |
| Molecular Mass : | Calculated molecular mass 49.2 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation |
| AA Sequence : | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ GNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEV FWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEAST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK |
| Endotoxin : | < 0.1 EU/ μg of purified recombinant protein determined by the LAL method |
| Purity : | > 95 % by SDS-PAGE under reducing condition |
| Characteristic : | Disulfide-linked homodimer Labeled with FITC via amines Excitation source: 488 nm spectral line, argon-ion laser Excitation Wavelength: 488 nm Emission Wavelength: 535 nm |
| Storage : | The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Supplied at 0.5 mg/ml in sterile PBS pH 7.4 (carrier free). |
| Conjugation : | FITC |
| Gene Name | CD276 CD276 molecule [ Homo sapiens ] |
| Official Symbol | CD276 |
| Synonyms | CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3; |
| Gene ID | 80381 |
| mRNA Refseq | NM_001024736 |
| Protein Refseq | NP_001019907 |
| MIM | 605715 |
| UniProt ID | Q5ZPR3 |
| ◆ Recombinant Proteins | ||
| CD276-1287MF | Recombinant Mouse Cd276 Protein, hFc-tagged, FITC conjugated | +Inquiry |
| CD276-33H | Recombinant Human CD276 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cd276-41RAF488 | Recombinant Rat Cd276 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| Cd276-40RP | Recombinant Rat Cd276 protein, Fc-tagged, R-PE labeled | +Inquiry |
| CD276-1235CAF555 | Recombinant Monkey CD276 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD276-001MCL | Recombinant Mouse CD276 cell lysate | +Inquiry |
| CD276-1959HCL | Recombinant Human CD276 cell lysate | +Inquiry |
| CD276-826RCL | Recombinant Rat CD276 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD276 Products
Required fields are marked with *
My Review for All CD276 Products
Required fields are marked with *
