Active Recombinant Human CD33, Fc-tagged, Biotinylated
Cat.No. : | CD33-675H |
Product Overview : | The recombinant human CD33-Fc is expressed as a 471 amino acid protein consisting of Asp18 - Gly260 region of CD33 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 18-260 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized protein supports the adhesion of human red blood cells. Binds anti-CD33/SIGLEC-3 monoclonal antibody, human IgG1 with high affinity (KD< 10 nM) by a functional ELISA. |
Molecular Mass : | Calculated molecular mass (kDa): 52.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 (probably due to glycosylation) |
AA Sequence : | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFR LLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSV SWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNP TTGIFPGDGSGKQETRAGVVHGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | CD33 CD33 molecule [ Homo sapiens ] |
Official Symbol | CD33 |
Synonyms | CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3; |
Gene ID | 945 |
mRNA Refseq | NM_001082618 |
Protein Refseq | NP_001076087 |
MIM | 159590 |
UniProt ID | P20138 |
Chromosome Location | 19q13.3 |
Pathway | Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | receptor activity; sugar binding; |
◆ Recombinant Proteins | ||
CD33-313H | Recombinant Human CD33, Fc tagged | +Inquiry |
CD33-0711H | Active Recombinant Human CD33 protein, His-tagged, FITC-Labeled | +Inquiry |
CD33-051H | Active Recombinant Human CD33 protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD33-234HAF488 | Recombinant Human CD33 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD33-313HAF647 | Recombinant Human CD33 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD33-1808MCL | Recombinant Mouse CD33 cell lysate | +Inquiry |
CD33-978HCL | Recombinant Human CD33 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD33 Products
Required fields are marked with *
My Review for All CD33 Products
Required fields are marked with *