Active Recombinant Human CD47 Protein, His-tagged
Cat.No. : | CD47-08H |
Product Overview : | Recombinant human CD47 (19-141 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 129 |
Description : | This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Human SIRP gamma/CD172g. |
Molecular Mass : | 14.7 kDa |
AA Sequence : | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | CD47 CD47 molecule [ Homo sapiens (human) ] |
Official Symbol | CD47 |
Synonyms | CD47; CD47 molecule; IAP; OA3; MER6; leukocyte surface antigen CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 glycoprotein; Rh-related antigen; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; integrin associated protein; integrin-associated signal transducer |
Gene ID | 961 |
mRNA Refseq | NM_001777 |
Protein Refseq | NP_001768 |
MIM | 601028 |
UniProt ID | Q08722 |
◆ Recombinant Proteins | ||
C-1038R | Recombinant Rat C Protein | +Inquiry |
C -74H | Recombinant Hepatitis B Virus C protein | +Inquiry |
C-696R | Recombinant Rat C Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL20-518H | Recombinant Human CCL20 Protein, Fc-tagged | +Inquiry |
HBcAg-19H | Recombinant Hepatitis B Virus C protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C Products
Required fields are marked with *
My Review for All C Products
Required fields are marked with *
0
Inquiry Basket