Active Recombinant Human CD80, His-tagged, Biotinylated
Cat.No. : | CD80-581H |
Product Overview : | The recombinant human CD80 ECD protein is expressed as a 220 amino acid protein consisting of Val35 - Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 35-242 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds human CD28, CTLA4 and PD-L1. Induces IL-2 secretion in human T cells. |
Molecular Mass : | Calculated molecular mass 25.3 kDa; estimated by SDS-PAGE under reducing condition 45-55 kDa probably due to glycosylation. |
AA Sequence : | VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRP SDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEEL NAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGHHHHHHHH |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CD80 CD80 molecule [ Homo sapiens ] |
Official Symbol | CD80 |
Synonyms | CD80; CD80 molecule; CD28LG, CD28LG1, CD80 antigen (CD28 antigen ligand 1, B7 1 antigen) , CD80 molecule; T-lymphocyte activation antigen CD80; B lymphocyte activation antigen B7; B7 1; B7.1; activation B7-1 antigen; costimulatory factor CD80; CTLA-4 counter-receptor B7.1; B-lymphocyte activation antigen B7; costimulatory molecule variant IgV-CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); B7; BB1; B7-1; LAB7; CD28LG; CD28LG1; |
Gene ID | 941 |
mRNA Refseq | NM_005191 |
Protein Refseq | NP_005182 |
MIM | 112203 |
UniProt ID | P33681 |
Chromosome Location | 3q13.3-q21 |
Pathway | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; |
Function | coreceptor activity; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
CD80-1376H | Acitve Recombinant Human CD80 protein(Met1-Asn242), His&Avi-tagged, Biotinylated | +Inquiry |
CD80-137CAF647 | Recombinant Monkey CD80 Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD80-560H | Active Recombinant Human CD80 protein, His-tagged | +Inquiry |
CD80-591HAF647 | Recombinant Human CD80 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD80-590HAF647 | Recombinant Human CD80 Protein, Alexa Fluor 647 conjugated | +Inquiry |
◆ Native Proteins | ||
CD80-60H | Active Recombinant Human CD80 Protein, Flag&His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD80-948CCL | Recombinant Cynomolgus CD80 cell lysate | +Inquiry |
CD80-2715HCL | Recombinant Human CD80 cell lysate | +Inquiry |
CD80-1767MCL | Recombinant Mouse CD80 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD80 Products
Required fields are marked with *
My Review for All CD80 Products
Required fields are marked with *
0
Inquiry Basket