Active Recombinant Human CD80, His-tagged, Biotinylated

Cat.No. : CD80-581H
Product Overview : The recombinant human CD80 ECD protein is expressed as a 220 amino acid protein consisting of Val35 - Asn242 region of CD80 (UniProt accession #P33681) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 35-242 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds human CD28, CTLA4 and PD-L1. Induces IL-2 secretion in human T cells.
Molecular Mass : Calculated molecular mass 25.3 kDa; estimated by SDS-PAGE under reducing condition 45-55 kDa probably due to glycosylation.
AA Sequence : VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRP SDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEEL NAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name CD80 CD80 molecule [ Homo sapiens ]
Official Symbol CD80
Synonyms CD80; CD80 molecule; CD28LG, CD28LG1, CD80 antigen (CD28 antigen ligand 1, B7 1 antigen) , CD80 molecule; T-lymphocyte activation antigen CD80; B lymphocyte activation antigen B7; B7 1; B7.1; activation B7-1 antigen; costimulatory factor CD80; CTLA-4 counter-receptor B7.1; B-lymphocyte activation antigen B7; costimulatory molecule variant IgV-CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); B7; BB1; B7-1; LAB7; CD28LG; CD28LG1;
Gene ID 941
mRNA Refseq NM_005191
Protein Refseq NP_005182
MIM 112203
UniProt ID P33681
Chromosome Location 3q13.3-q21
Pathway Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem;
Function coreceptor activity; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD80 Products

Required fields are marked with *

My Review for All CD80 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon