| Species : |
Human |
| Source : |
Insect cells |
| Tag : |
His |
| Protein Length : |
450aa |
| Description : |
This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis. |
| Form : |
Liquid |
| Bio-activity : |
Specific activity is > 1,000 pmol/min/μg, and is defined as the amount of enzyme that sulfate from PAPS to Chondroitin Sulfate per minute at pH 7.5, at 25 centigrade. |
| Molecular Mass : |
51.3kDa |
| AA Sequence : |
EKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 90% by SDS - PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.25 mg/mL |
| Storage Buffer : |
In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |