Active Recombinant Human CHST3 Protein, His-tagged

Cat.No. : CHST3-01H
Product Overview : Recombinant human CHST3 protein (39-479aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 450aa
Description : This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis.
Form : Liquid
Bio-activity : Specific activity is > 1,000 pmol/min/μg, and is defined as the amount of enzyme that sulfate from PAPS to Chondroitin Sulfate per minute at pH 7.5, at 25 centigrade.
Molecular Mass : 51.3kDa
AA Sequence : EKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Applications : SDS-PAGE, Enzyme Activity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name CHST3 carbohydrate sulfotransferase 3 [ Homo sapiens (human) ]
Official Symbol CHST3
Synonyms CHST3; carbohydrate sulfotransferase 3; carbohydrate sulfotransferase 3; C6ST-1; GST-0; carbohydrate (chondroitin 6) sulfotransferase 3; chondroitin 6 sulfotransferase 1; chondroitin 6-O-sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; EC 2.8.2.17
Gene ID 9469
mRNA Refseq NM_004273.5
Protein Refseq NP_004264
MIM 603799
UniProt ID Q7LGC8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST3 Products

Required fields are marked with *

My Review for All CHST3 Products

Required fields are marked with *

0
cart-icon
0
compare icon