Active Recombinant Human CTF1 Protein (201 aa)
Cat.No. : | CTF1-295C |
Product Overview : | Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Protein Length : | 201 |
Description : | Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.4 ng/mL, measured in a cell proliferation assay using TF-1 cells. |
Molecular Mass : | 24~26kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Cardiotrophin-1(CT-1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Cardiotrophin-1(CT-1) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CTF1 cardiotrophin 1 [ Homo sapiens ] |
Official Symbol | CTF1 |
Synonyms | CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1; |
Gene ID | 1489 |
mRNA Refseq | NM_001142544 |
Protein Refseq | NP_001136016 |
MIM | 600435 |
UniProt ID | Q16619 |
◆ Recombinant Proteins | ||
CTF1-295C | Active Recombinant Human CTF1 Protein (201 aa) | +Inquiry |
CTF1-138H | Recombinant Human CTF1 protein | +Inquiry |
Ctf1-049M | Active Recombinant Mouse Ctf1 Protein | +Inquiry |
Ctf1-183M | Recombinant Murine Cardiotrophin 1 | +Inquiry |
CTF1-184H | Active Recombinant Human Cardiotrophin 1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTF1-001HCL | Recombinant Human CTF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTF1 Products
Required fields are marked with *
My Review for All CTF1 Products
Required fields are marked with *