Active Recombinant Human CTF1 Protein (201 aa)

• Cat.No.: CTF1-295C
• Product Overview: Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence.

Specification

• Species: Human
• Source: CHO
• Protein Length: 201
• Description: Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.4 ng/mL, measured in a cell proliferation assay using TF-1 cells.
• Molecular Mass: 24~26kDa, observed by reducing SDS-PAGE.
• AA Sequence: SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Cardiotrophin-1(CT-1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Cardiotrophin-1(CT-1) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CTF1 cardiotrophin 1 [ Homo sapiens ]
• Official Symbol: CTF1
• Synonyms: CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1
• Gene ID: 1489
• mRNA Refseq: NM_001142544
• Protein Refseq: NP_001136016
• MIM: 600435
• UniProt ID: Q16619