Active Recombinant Human CTF1 Protein (201 aa)

Cat.No. : CTF1-295C
Product Overview : Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Protein Length : 201
Description : Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.4 ng/mL, measured in a cell proliferation assay using TF-1 cells.
Molecular Mass : 24~26kDa, observed by reducing SDS-PAGE.
AA Sequence : SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human Cardiotrophin-1(CT-1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Cardiotrophin-1(CT-1) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CTF1 cardiotrophin 1 [ Homo sapiens ]
Official Symbol CTF1
Synonyms CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1;
Gene ID 1489
mRNA Refseq NM_001142544
Protein Refseq NP_001136016
MIM 600435
UniProt ID Q16619

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTF1 Products

Required fields are marked with *

My Review for All CTF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon