Active Recombinant Human CXCL12, His-tagged

• Cat.No.: CXCL12-21H
• Product Overview: Human N-his-tag SDF-1 β produced in E. coli is non-glycosylated polypeptide chain containing 100 amino acids (28-100 a.a; predicted MW=11.67kDa). The SDF-1 β is fused to 28 amino acid His-tag at N-terminal. The recombinant protein was purified by Ni-NTA affinity column and followed by gel filtration chromatography.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 28-100 a.a.
• Description: SDF-1 (stromal cell-derived factor-1), also called CXCL12, is small cytokine belonging to the chemokine family. The two forms, SDF-1 alpha/CXCL12a and SDF-1 β/CXCL12b, are produced in cells by alternate splicing of the same gene. SDF-1 signal through its receptor CXCR4, and have been shown to chemoattract B and T cells, induce migration of CD34+ stem cells. Additionally, SDF-1 and its receptor CXCR4 are involved in human disease states (e.g. HIV/AIDS) and cancer metastasis.
• Form: Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/ml in PBS.
• Bio-activity: The protein was active in ELISA assay with an EC50 of about 160nM.
• Molecular Mass: The measure MW in LC-MS was 11548 Dalton, in agreement with its theoretic molecular weight.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMENLYFQGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALNNRQVCIDPKL KWIQEYLEKALNKRFKM
• Purity: Purity was greater than 95% by Coomassie blue staining SDS-PAGE
• Storage: Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml.

Gene Information

• Gene Name: CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ]
• Official Symbol: CXCL12
• Synonyms: CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B
• Gene ID: 6387
• mRNA Refseq: NM_000609
• Protein Refseq: NP_000600
• MIM: 600835
• UniProt ID: P48061
• Chromosome Location: 10q11.1
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem
• Function: CXCR chemokine receptor binding; chemokine activity; growth factor activity; receptor binding