Active Recombinant Human CXCL12, His-tagged
| Cat.No. : | CXCL12-21H |
| Product Overview : | Human N-his-tag SDF-1 β produced in E. coli is non-glycosylated polypeptide chain containing 100 amino acids (28-100 a.a; predicted MW=11.67kDa). The SDF-1 β is fused to 28 amino acid His-tag at N-terminal. The recombinant protein was purified by Ni-NTA affinity column and followed by gel filtration chromatography. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-100 a.a. |
| Description : | SDF-1 (stromal cell-derived factor-1), also called CXCL12, is small cytokine belonging to the chemokine family. The two forms, SDF-1 alpha/CXCL12a and SDF-1 β/CXCL12b, are produced in cells by alternate splicing of the same gene. SDF-1 signal through its receptor CXCR4, and have been shown to chemoattract B and T cells, induce migration of CD34+ stem cells. Additionally, SDF-1 and its receptor CXCR4 are involved in human disease states (e.g. HIV/AIDS) and cancer metastasis. |
| Form : | Lyophilized from a 0.22μm filtered solution at a concentration of 1mg/ml in PBS. |
| Bio-activity : | The protein was active in ELISA assay with an EC50 of about 160nM. |
| Molecular Mass : | The measure MW in LC-MS was 11548 Dalton, in agreement with its theoretic molecular weight. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMENLYFQGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALNNRQVCIDPKL KWIQEYLEKALNKRFKM |
| Purity : | Purity was greater than 95% by Coomassie blue staining SDS-PAGE |
| Storage : | Upon reconstitution, the preparation is stable for up to 1 month at 2-8°C. For long term storage, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 1.0 mg/ml. |
| Gene Name | CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ] |
| Official Symbol | CXCL12 |
| Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B; |
| Gene ID | 6387 |
| mRNA Refseq | NM_000609 |
| Protein Refseq | NP_000600 |
| MIM | 600835 |
| UniProt ID | P48061 |
| Chromosome Location | 10q11.1 |
| Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; |
| Function | CXCR chemokine receptor binding; chemokine activity; growth factor activity; receptor binding; |
| ◆ Recombinant Proteins | ||
| CXCL12-23H | Recombinant Human CXCL12 Protein, Biotin-tagged | +Inquiry |
| CXCL12-383C | Recombinant Canine CXCL12 protein(Lys22-Met93) | +Inquiry |
| CXCL12-6079C | Recombinant Chicken CXCL12 | +Inquiry |
| Cxcl12-521R | Active Recombinant Rat Cxcl12 protein, His-GST-tagged | +Inquiry |
| CXCL12-629H | Recombinant Human CXCL12 protein(Lys22-Lys89) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
| CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL12 Products
Required fields are marked with *
My Review for All CXCL12 Products
Required fields are marked with *
