Active Recombinant Human CXCL13 Protein
Cat.No. : | CXCL13-132H |
Product Overview : | Recombinant Human CXCL13 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 87 AA |
Description : | B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by its ability to chemoattract human B cells using a concentration range of 1-10 ng/mL corresponding to a Specific Activity of 100,000-1,000,000 IU/mg. |
Molecular Mass : | 10.3 kDa |
AA Sequence : | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP. |
Purity : | Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Notes : | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Storage : | Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution BCA1 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | 20mM PBS & 150mM NaCl pH7.4. |
Shipping : | Room temperature. |
Gene Name | CXCL13 C-X-C motif chemokine ligand 13 [ Homo sapiens (human) ] |
Official Symbol | CXCL13 |
Synonyms | CXCL13; C-X-C motif chemokine ligand 13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13; C-X-C motif chemokine 13; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); B-lymphocyte chemoattractant; CXC chemokine BLC; b cell-attracting chemokine 1; b lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small-inducible cytokine B13 |
Gene ID | 10563 |
mRNA Refseq | NM_006419 |
Protein Refseq | NP_006410 |
MIM | 605149 |
UniProt ID | O43927 |
◆ Recombinant Proteins | ||
CXCL13-08H | Active Recombinant Human CXCL13 Protein (Val23-Arg94), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL13-50R | Recombinant Rat C-X-C motif chemokine ligand 13 Protein, His&SUMO tagged | +Inquiry |
CXCL13-1695H | Recombinant Human CXCL13 Protein (Val23-Arg94), N-His tagged | +Inquiry |
CXCL13-1710H | Recombinant Human CXCL13 protein, His-Sumo-tagged | +Inquiry |
Cxcl13-5643M | Recombinant Mouse Cxcl13 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL13 Products
Required fields are marked with *
My Review for All CXCL13 Products
Required fields are marked with *