Active Recombinant Human CXCL2 Protein (74 aa)

• Cat.No.: CXCL2-388C
• Product Overview: Recombinant Human GRO beta/CXCL2 produced in E. coli is a single non-glycosylated polypeptide chain containing 74 amino acids. A fully biologically active molecule, rhGRO beta/CXCL2 has a molecular mass of 8.0 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 74
• Description: Human GRO-α, GRO-β (MIP-2α), and GRO-γ (MIP-2β) are products of three distinct, nonallelichuman genes. GRO-β and GRO-γ share 90% and 86% amino acid sequence homology, respectively, with GROα. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors.GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.Similar to other alpha chemokines, the three GRO proteins are potent neutrophil attractants and activators. In addition, these chemokines are also active toward basophils.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of human GRO beta on Ca^2+ mobilization assay in CHO-K1/Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/mL.
• Molecular Mass: 8.0 kDa, observed by reducing SDS-PAGE.
• AA Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human GRO beta/CXCL2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human GRO beta/CXCL2 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
• Official Symbol: CXCL2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a
• Gene ID: 2920
• mRNA Refseq: NM_002089
• Protein Refseq: NP_002080
• MIM: 139110
• UniProt ID: P19875