| Species : |
Mouse |
| Source : |
E.coli |
| Protein Length : |
73 |
| Description : |
Macrophage Inflammatory Protein 2 (MIP-2) was originally identified as a heparin binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. Based on its protein and DNA sequences, MIP-2 is a member of the alpha (CXC) subfamily of chemokines. Similarly to other alpha chemokines, murine MIP-2 is a potent neutrophil attractant and activator. MIP-2 and KC can bind the murine interleukin 8 type B receptor homologue with high affinity. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Fully biologically active when compared to standard. Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg. |
| Molecular Mass : |
7.8 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids. |
| AA Sequence : |
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Endotoxin : |
Less than 1 EU/mg of rMuMIP-2/CXCL2 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |