Active Recombinant Human CXCL5 Protein (74 aa)

Cat.No. : CXCL5-131C
Product Overview : Recombinant Human CXCL5 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 74
Description : Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg.
Molecular Mass : 8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
AA Sequence : AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Endotoxin : Less than 1 EU/mg of rHuENA-78/CXCL5 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ]
Official Symbol CXCL5
Synonyms CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78;
Gene ID 6374
mRNA Refseq NM_002994
Protein Refseq NP_002985
MIM 600324
UniProt ID P42830

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL5 Products

Required fields are marked with *

My Review for All CXCL5 Products

Required fields are marked with *

0
cart-icon
0
compare icon