Active Recombinant Human CXCL5 Protein (78 aa)

• Cat.No.: CXCL5-190C
• Product Overview: Recombinant ENA-78/CXCL5 produced in 293 cells is a single polypeptide chain containing 78 amino acids. rhENA-78/CXCL5 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: HEK293
• Protein Length: 78
• Description: Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of ENA-78 has also been observed in eosinophils, and can be inhibited with the type II interferon,IFN-γ. ENA-78 stimulates the chemotaxis of neutrophils possessing angiogenic properties. It plays a role in reducing sensitivity to sunburn pain in some subjects, and could be a potential target used to understand more about pain in other inflammatory conditions. ENA-78 is well known to have chemotactic and activating functions on neutrophils, mainly during acute inflammatory responses. It can signal through the CXCR2 receptor.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of human ENA-78/CXCL5 on Ca^2+ mobilization assay in CHO-K1/Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/mL.
• Molecular Mass: 8.5 kDa, observed by reducing SDS-PAGE.
• AA Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 98% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant human ENA-78/CXCL5 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human ENA-78/CXCL5 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ]
• Official Symbol: CXCL5
• Synonyms: CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78
• Gene ID: 6374
• mRNA Refseq: NM_002994
• Protein Refseq: NP_002985
• MIM: 600324
• UniProt ID: P42830