Active Recombinant Human CXCL8 Protein (77 aa)

Cat.No. : CXCL8-350C
Product Overview : Recombinant human Interleukin-8 (IL-8, 77aa)/CXCL8 produced in E. coli is a single non-glycosylated polypeptide chain containing 77 amino acids. A fully biologically active molecule, rhIL-8(77aa)/CXCL8 has a molecular mass of 8.9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 77
Description : Interleukin-8 is one of the first discovered chemokines and belongs to the CXCL family, in which the first two conserved cysteines are separated by one residue. In vivo, IL-8 exists in two forms: a 77 a.a. protein produced by endothelial cells, and the more active 72 a.a. protein produced by monocytes. The receptors for IL-8 are the seven-helical G-protein coupled receptors CXCR1 and CXCR2, exclusively expressed on neutrophils. The functions of IL-8 are to induce rapid changes in cell morphology, activate integrins, and release the granule contents of neutrophils. Thus, IL-8 can enhance the antimicrobial actions of defense cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of human IL-8(77aa) on Ca^2+ mobilization assay in CHO-K1/Gα15/hCXCR1 cells (human Gα15 and human CXCR1 stably expressed in CHO-K1 cells) is less than 150 ng/mL.
Molecular Mass : 8.9 kDa, observed by reducing SDS-PAGE.
AA Sequence : AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant human Interleukin-8 (IL-8)(77aa)/CXCL8 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant human Interleukin-8 (IL-8)(77aa)/CXCL8 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ]
Official Symbol CXCL8
Synonyms CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1
Gene ID 3576
mRNA Refseq NM_000584
Protein Refseq NP_000575
MIM 146930
UniProt ID P10145

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL8 Products

Required fields are marked with *

My Review for All CXCL8 Products

Required fields are marked with *

0
cart-icon