Active Recombinant Human CXCL8 Protein (77 aa)
| Cat.No. : | CXCL8-350C |
| Product Overview : | Recombinant human Interleukin-8 (IL-8, 77aa)/CXCL8 produced in E. coli is a single non-glycosylated polypeptide chain containing 77 amino acids. A fully biologically active molecule, rhIL-8(77aa)/CXCL8 has a molecular mass of 8.9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 77 |
| Description : | Interleukin-8 is one of the first discovered chemokines and belongs to the CXCL family, in which the first two conserved cysteines are separated by one residue. In vivo, IL-8 exists in two forms: a 77 a.a. protein produced by endothelial cells, and the more active 72 a.a. protein produced by monocytes. The receptors for IL-8 are the seven-helical G-protein coupled receptors CXCR1 and CXCR2, exclusively expressed on neutrophils. The functions of IL-8 are to induce rapid changes in cell morphology, activate integrins, and release the granule contents of neutrophils. Thus, IL-8 can enhance the antimicrobial actions of defense cells. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | The EC50 value of human IL-8(77aa) on Ca^2+ mobilization assay in CHO-K1/Gα15/hCXCR1 cells (human Gα15 and human CXCR1 stably expressed in CHO-K1 cells) is less than 150 ng/mL. |
| Molecular Mass : | 8.9 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant human Interleukin-8 (IL-8)(77aa)/CXCL8 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant human Interleukin-8 (IL-8)(77aa)/CXCL8 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | CXCL8 C-X-C motif chemokine ligand 8 [ Homo sapiens (human) ] |
| Official Symbol | CXCL8 |
| Synonyms | CXCL8; C-X-C motif chemokine ligand 8; IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; SCYB8; interleukin-8; T-cell chemotactic factor; alveolar macrophage chemotactic factor I; beta endothelial cell-derived neutrophil activating peptide; beta-thromboglobulin-like protein; chemokine (C-X-C motif) ligand 8; emoctakin; granulocyte chemotactic protein 1; interleukin 8; lung giant cell carcinoma-derived chemotactic protein; lymphocyte derived neutrophil activating peptide; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; neutrophil-activating peptide 1; small inducible cytokine subfamily B, member 8; tumor necrosis factor-induced gene 1 |
| Gene ID | 3576 |
| mRNA Refseq | NM_000584 |
| Protein Refseq | NP_000575 |
| MIM | 146930 |
| UniProt ID | P10145 |
| ◆ Recombinant Proteins | ||
| CXCL8-4384C | Recombinant Cynomolgus Monkey CXCL8 Protein | +Inquiry |
| CXCL8-052H | Active Recombinant Human CXCL8 Protein | +Inquiry |
| CXCL8-002H | Recombinant Human CXCL8 Protein, His-tagged | +Inquiry |
| CXCL8-3108C | Recombinant Chicken CXCL8 protein, His-tagged | +Inquiry |
| CXCL8-184H | Recombinant Human CXCL8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL8 Products
Required fields are marked with *
My Review for All CXCL8 Products
Required fields are marked with *



