Active Recombinant Human DPP4 protein, His-tagged
Cat.No. : | DPP4-215H |
Product Overview : | Recombinant Human DPP4(39 a.a. - 766 a.a.) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 39-766 a.a. |
Description : | The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. |
Form : | In 20 mM Tris-HCl, 100 mM NaCl, 1 mM EDTA, pH 8.0 (10% glycerol) |
Bio-activity : | Approximately > 50 Unit/mg. |
Molecular Mass : | 86.4 kDa |
AA Sequence : | ADPRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDG QFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRIT WTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGA VNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGR WNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALT SDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSV NDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRL NWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVT SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNV HFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP-SGRLVPRGSHHHHHH |
Endotoxin : | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Unit Definition : | One unit will hydrolyze 1 umole of p-nitroaniline per minute at pH 8.0 at 37 centigrade using 1mM of Gly-Pro p-nitroanilde as a substrate. |
Applications : | Functional Study; SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade.Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL |
Gene Name | DPP4 dipeptidyl-peptidase 4 [ Homo sapiens ] |
Official Symbol | DPP4 |
Synonyms | DPP4; dipeptidyl-peptidase 4; ADCP2, adenosine deaminase complexing protein 2 , CD26, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); dipeptidyl peptidase 4; DPPIV; ADCP-2; DPP IV; dipeptidylpeptidase 4; dipeptidyl peptidase IV; T-cell activation antigen CD26; adenosine deaminase complexing protein 2; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); CD26; ADABP; ADCP2; TP103; |
Gene ID | 1803 |
mRNA Refseq | NM_001935 |
Protein Refseq | NP_001926 |
MIM | 102720 |
UniProt ID | P27487 |
Chromosome Location | 2q23-qter |
Pathway | Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem; |
Function | aminopeptidase activity; collagen binding; dipeptidyl-peptidase activity; peptidase activity; peptide binding; protease binding; protein binding; protein homodimerization activity; receptor activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity; |
◆ Recombinant Proteins | ||
DPP4-10H | Active Recombinant Human DPP4 Protein (29-766aa), C-hIgG-tagged | +Inquiry |
Dpp4-120M | Recombinant Mouse Dpp4, Fc-tagged | +Inquiry |
DPP4-2845H | Recombinant Human DPP4 Protein, GST-tagged | +Inquiry |
DPP4-3739H | Human 1PFQ | +Inquiry |
DPP4-675H | Recombinant Human DPP4 protein(29-766aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
DPP4-31H | Active Native Human DPP4 | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPP4-733CCL | Recombinant Cynomolgus DPP4 cell lysate | +Inquiry |
DPP4-2979HCL | Recombinant Human DPP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPP4 Products
Required fields are marked with *
My Review for All DPP4 Products
Required fields are marked with *
0
Inquiry Basket