Active Recombinant Human DPP4 protein, His-tagged

Cat.No. : DPP4-215H
Product Overview : Recombinant Human DPP4(39 a.a. - 766 a.a.) fused with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 39-766 a.a.
Description : The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides.
Form : In 20 mM Tris-HCl, 100 mM NaCl, 1 mM EDTA, pH 8.0 (10% glycerol)
Bio-activity : Approximately > 50 Unit/mg.
Molecular Mass : 86.4 kDa
AA Sequence : ADPRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDG QFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRIT WTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGA VNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGR WNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALT SDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSV NDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRL NWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVT SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNV HFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP-SGRLVPRGSHHHHHH
Endotoxin : < 1.0 EU per 1 microgram of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Unit Definition : One unit will hydrolyze 1 umole of p-nitroaniline per minute at pH 8.0 at 37 centigrade using 1mM of Gly-Pro p-nitroanilde as a substrate.
Applications : Functional Study; SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade.Aliquot to avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL
Gene Name DPP4 dipeptidyl-peptidase 4 [ Homo sapiens ]
Official Symbol DPP4
Synonyms DPP4; dipeptidyl-peptidase 4; ADCP2, adenosine deaminase complexing protein 2 , CD26, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); dipeptidyl peptidase 4; DPPIV; ADCP-2; DPP IV; dipeptidylpeptidase 4; dipeptidyl peptidase IV; T-cell activation antigen CD26; adenosine deaminase complexing protein 2; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); CD26; ADABP; ADCP2; TP103;
Gene ID 1803
mRNA Refseq NM_001935
Protein Refseq NP_001926
MIM 102720
UniProt ID P27487
Chromosome Location 2q23-qter
Pathway Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem;
Function aminopeptidase activity; collagen binding; dipeptidyl-peptidase activity; peptidase activity; peptide binding; protease binding; protein binding; protein homodimerization activity; receptor activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPP4 Products

Required fields are marked with *

My Review for All DPP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon