Active Recombinant Human EGFR, Fc-tagged, Biotinylated
| Cat.No. : | EGFR-602H |
| Product Overview : | Recombinant Human EGFR Protein extracellular domain (ECD, 25-638aa), was expressed in Human Cells with C-terminal human IgG1 Fc tag (exists as dimer under non-reducing condition; total 850 amino acids). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 25-638 aa |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | he recombinant Fc-fusion protein blocks anti-EGFR mAbs and therapeutic mAb such as Erbitux and Vectbix binding to EGFR ECD as measured by ELISA and to cell surface EGFR by flow cytometry or cell-based ELISA. |
| Molecular Mass : | Calculated molecular mass (kDa): 94.4; Estimated by SDS-PAGE under reducing condition (kDa): ~100 |
| AA Sequence : | LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERI PLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFL SNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESD CLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEED GVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDIL KTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNL CYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLE GEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVC HLCHPNCTYGCTGPGLEGCPTSTGDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
| Official Symbol | EGFR |
| Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
| Gene ID | 1956 |
| mRNA Refseq | NM_005228 |
| Protein Refseq | NP_005219 |
| MIM | 131550 |
| UniProt ID | P00533 |
| Chromosome Location | 7p12 |
| Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bladder cancer, organism-specific biosystem; |
| Function | ATP binding; MAPK/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding; epidermal growth factor-activated receptor activity; epidermal growth factor-activated receptor activity; identical protein binding; contributes_to nitric-oxide synthase regulator activity; nucleotide binding; protein binding; protein heterodimerization activity; protein phosphatase binding; protein tyrosine kinase activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; signal transducer activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| EGFR-28468TH | Recombinant Human EGFR | +Inquiry |
| EGFR-1227RAF647 | Recombinant Monkey EGFR Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| EGFR-052H | Biotinylated Active Recombinant Human EGFR protein, His/Avi-tagged | +Inquiry |
| EGFR-464HA | Recombinant Human EGFR protein, Fc-tagged, APC labeled | +Inquiry |
| EGFR-61CAF555 | Recombinant Monkey EGFR Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
| EGFR-151HKCL | Human EGFR Knockdown Cell Lysate | +Inquiry |
| EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
| EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
