Active Recombinant Human EGFRvIII Protein, His & Avi-tagged, Biotinylated

• Cat.No.: EGFR-341H
• Product Overview: Recombinant Human EGFRvIII Protein (NP_005219.2, 25-645aa, 30-297aa: Val Cys Gln...Cys Pro Arg → Gly mutation), was expressed in human 293 cells (HEK293) with C-terminal Avi tag, His tag and biotinylated conjugate.

Specification

• Species: Human
• Source: HEK293
• Tag: Avi&His
• Protein Length: 25-645 aa
• Form: Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization.
• Bio-activity: Immobilized CetuxiMabat 2 μg/mL (100 μL/well) can bind Recombinant Human EGFRvIII Protein, His & Avi-tagged, Biotinylated with a linear range of 0.4-25 ng/mL (QC tested).
• Molecular Mass: 41.3 kDa
• AA Sequence: LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSGLNDIFEAQKIEWHEHHHHHH
• Endotoxin: Less than 1.0 EU per μg by the LAL method.
• Purity: >95% as determined by SDS-PAGE.
• Notes: Please avoid repeated freeze-thaw cycles.
• Stability: No activity loss is observed after storage at:
  4-8 centigrade for 12 months in lyophilized state;
  -70 centigrade for 3 months under sterile conditions after reconstitution.
• Storage: For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 mg/ml. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
• Conjugation: Biotin

Gene Information

• Gene Name: EGFR epidermal growth factor receptor [ Homo sapiens ]
• Official Symbol: EGFR
• Synonyms: EGFR; epidermal growth factor receptor; ERBB1; ERBB; HER1; mENA; PIG61
• Gene ID: 1956
• mRNA Refseq: NM_005228
• Protein Refseq: NP_005219
• MIM: 131550
• UniProt ID: P00533