Active Recombinant Human EPGN Protein (72 aa)

Cat.No. : EPGN-126E
Product Overview : Recombinant Human EPGN Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 72
Description : Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated 14.7 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells. The expected ED50 for this effect is 150-300 ng/mL, corresponding to a Specific Activity of >3.3× 10^3 IU/mg.
Molecular Mass : Approximately 7.9kDa monomeric protein, containing 72 amino acid residues, which comprises the EGF homologous portion of the Epigen precursor.
AA Sequence : AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Endotoxin : Less than 1 EU/mg of rHuEPG as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ]
Official Symbol EPGN
Synonyms EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542;
Gene ID 255324
mRNA Refseq NM_001013442
Protein Refseq NP_001013460
MIM 618717
UniProt ID Q6UW88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPGN Products

Required fields are marked with *

My Review for All EPGN Products

Required fields are marked with *

0
cart-icon