Active Recombinant Human EPGN Protein (72 aa)
Cat.No. : | EPGN-126E |
Product Overview : | Recombinant Human EPGN Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 72 |
Description : | Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated 14.7 kDa transmembrane precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells. The expected ED50 for this effect is 150-300 ng/mL, corresponding to a Specific Activity of >3.3× 10^3 IU/mg. |
Molecular Mass : | Approximately 7.9kDa monomeric protein, containing 72 amino acid residues, which comprises the EGF homologous portion of the Epigen precursor. |
AA Sequence : | AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA |
Endotoxin : | Less than 1 EU/mg of rHuEPG as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ] |
Official Symbol | EPGN |
Synonyms | EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542; |
Gene ID | 255324 |
mRNA Refseq | NM_001013442 |
Protein Refseq | NP_001013460 |
MIM | 618717 |
UniProt ID | Q6UW88 |
◆ Recombinant Proteins | ||
EPGN-235H | Recombinant Human EPGN Protein, His-tagged | +Inquiry |
EPGN-423E | Active Recombinant Human EPGN Protein (73 aa) | +Inquiry |
EPGN-2332H | Recombinant Human EPGN, His-tagged | +Inquiry |
EPGN-4313HF | Recombinant Full Length Human EPGN Protein, GST-tagged | +Inquiry |
EPGN-014H | Active Recombinant Human EPGN protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPGN-249HCL | Recombinant Human EPGN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPGN Products
Required fields are marked with *
My Review for All EPGN Products
Required fields are marked with *
0
Inquiry Basket