Active Recombinant Human EPGN Protein

• Cat.No.: EPGN-290E
• Product Overview: Recombinant Human EPGN Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 μg/mL, measured in a proliferation assay using 3T3 cells.
• Molecular Mass: 15~20 kDa, observed by reducing SDS-PAGE.
• AA Sequence: AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Epigen remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ]
• Official Symbol: EPGN
• Synonyms: EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542
• Gene ID: 255324
• mRNA Refseq: NM_001013442
• Protein Refseq: NP_001013460
• MIM: 618717
• UniProt ID: Q6UW88