Active Recombinant Human EPGN Protein

Cat.No. : EPGN-290E
Product Overview : Recombinant Human EPGN Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 1 μg/mL, measured in a proliferation assay using 3T3 cells.
Molecular Mass : 15~20 kDa, observed by reducing SDS-PAGE.
AA Sequence : AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human Epigen remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ]
Official Symbol EPGN
Synonyms EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542;
Gene ID 255324
mRNA Refseq NM_001013442
Protein Refseq NP_001013460
MIM 618717
UniProt ID Q6UW88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPGN Products

Required fields are marked with *

My Review for All EPGN Products

Required fields are marked with *

0
cart-icon