Recombinant Full Length Human EPGN Protein, GST-tagged
Cat.No. : | EPGN-4313HF |
Product Overview : | Human EPGN full-length ORF ( AAI46548.1, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 133 amino acids |
Description : | The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Molecular Mass : | 41.58 kDa |
AA Sequence : | MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ] |
Official Symbol | EPGN |
Synonyms | EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542; |
Gene ID | 255324 |
mRNA Refseq | NM_001013442 |
Protein Refseq | NP_001013460 |
MIM | 618717 |
UniProt ID | Q6UW88 |
◆ Recombinant Proteins | ||
EPGN-235H | Recombinant Human EPGN Protein, His-tagged | +Inquiry |
EPGN-022H | Active Recombinant Human EPGN Protein | +Inquiry |
EPGN-1894C | Recombinant Chicken EPGN | +Inquiry |
Epgn-2174M | Recombinant Mouse Epgn Protein, His-tagged | +Inquiry |
Epgn-455M | Active Recombinant Mouse Epithelial Mitogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPGN-249HCL | Recombinant Human EPGN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPGN Products
Required fields are marked with *
My Review for All EPGN Products
Required fields are marked with *
0
Inquiry Basket