Active Recombinant Human EPGN Protein (73 aa)

Cat.No. : EPGN-423E
Product Overview : Recombinant human Epigen (rhEpigen) produced in E. coli is a single non-glycosylated polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhEpigen has a molecular mass of 8.1 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 73
Description : Epigen is a cytokine belonging to the Epidermal Growth Factor (EGF) superfamily, which also includes Epiregulin, Amphiregulin, Neuregulin 2-β, and Transforming Growth Factor α. The precursor of Epigen produced in tissues has 154 amino acids, and shares the characteristics of other members of EGF superfamily, including 3 disulfide bonds formed by 6 cysteines. Epigen is present in testis, heart, and liver, and it binds to EGF receptors with a much lower binding affinity than EGF. However, Epigen is more mitogenic than EGF. Epigen achieves its strong mitogenic potency by suppressing ligand-induced receptor inactivation. Unlike EGF, Epigen can also bind to EGF receptors in low pH conditions, helping its recycling. Therefore Epigen has anomalous potency due to its prolonged presence.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 1 μg/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 1 × 10^3 units/mg.
Molecular Mass : 8.1 kDa, observed by reducing SDS-PAGE.
AA Sequence : MAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant human Epigen (rhEpigen) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhEpigen remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ]
Official Symbol EPGN
Synonyms EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542;
Gene ID 255324
mRNA Refseq NM_001013442
Protein Refseq NP_001013460
MIM 618717
UniProt ID Q6UW88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPGN Products

Required fields are marked with *

My Review for All EPGN Products

Required fields are marked with *

0
cart-icon