| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
73 |
| Description : |
Epigen is a cytokine belonging to the Epidermal Growth Factor (EGF) superfamily, which also includes Epiregulin, Amphiregulin, Neuregulin 2-β, and Transforming Growth Factor α. The precursor of Epigen produced in tissues has 154 amino acids, and shares the characteristics of other members of EGF superfamily, including 3 disulfide bonds formed by 6 cysteines. Epigen is present in testis, heart, and liver, and it binds to EGF receptors with a much lower binding affinity than EGF. However, Epigen is more mitogenic than EGF. Epigen achieves its strong mitogenic potency by suppressing ligand-induced receptor inactivation. Unlike EGF, Epigen can also bind to EGF receptors in low pH conditions, helping its recycling. Therefore Epigen has anomalous potency due to its prolonged presence. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 1 μg/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 1 × 10^3 units/mg. |
| Molecular Mass : |
8.1 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% by SDS-PAGE analysis. |
| Storage : |
Lyophilized recombinant human Epigen (rhEpigen) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhEpigen remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |
