Active Recombinant Human EPGN Protein (73 aa)
Cat.No. : | EPGN-423E |
Product Overview : | Recombinant human Epigen (rhEpigen) produced in E. coli is a single non-glycosylated polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhEpigen has a molecular mass of 8.1 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 73 |
Description : | Epigen is a cytokine belonging to the Epidermal Growth Factor (EGF) superfamily, which also includes Epiregulin, Amphiregulin, Neuregulin 2-β, and Transforming Growth Factor α. The precursor of Epigen produced in tissues has 154 amino acids, and shares the characteristics of other members of EGF superfamily, including 3 disulfide bonds formed by 6 cysteines. Epigen is present in testis, heart, and liver, and it binds to EGF receptors with a much lower binding affinity than EGF. However, Epigen is more mitogenic than EGF. Epigen achieves its strong mitogenic potency by suppressing ligand-induced receptor inactivation. Unlike EGF, Epigen can also bind to EGF receptors in low pH conditions, helping its recycling. Therefore Epigen has anomalous potency due to its prolonged presence. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 1 μg/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 1 × 10^3 units/mg. |
Molecular Mass : | 8.1 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human Epigen (rhEpigen) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhEpigen remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ] |
Official Symbol | EPGN |
Synonyms | EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542; |
Gene ID | 255324 |
mRNA Refseq | NM_001013442 |
Protein Refseq | NP_001013460 |
MIM | 618717 |
UniProt ID | Q6UW88 |
◆ Recombinant Proteins | ||
EPGN-2332H | Recombinant Human EPGN, His-tagged | +Inquiry |
EPGN-1894C | Recombinant Chicken EPGN | +Inquiry |
EPGN-4313HF | Recombinant Full Length Human EPGN Protein, GST-tagged | +Inquiry |
EPGN-3373H | Recombinant Human EPGN Protein, GST-tagged | +Inquiry |
Epgn-2843M | Recombinant Mouse Epgn Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPGN-249HCL | Recombinant Human EPGN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPGN Products
Required fields are marked with *
My Review for All EPGN Products
Required fields are marked with *
0
Inquiry Basket