Active Recombinant Human ERBB3, Fc-tagged, Biotinylated
Cat.No. : | ERBB3-621H |
Product Overview : | Expressed as a 860 amino acid protein consisting of Ser20-Thr643 region of HER3 and a C-terminal Fc Fusion from human IgG1, which exists as a dimmer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 20-643 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | It was reported to inhibit the biological activity of Neuregulin-1 on MCF?7 human breast cancer cells. |
Molecular Mass : | Calculated molecular mass (kDa): 95.1; Estimated by SDS-PAGE under reducing condition (kDa): 98 |
AA Sequence : | SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEF STLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVR DRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTD CFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNG LKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTV REITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCY HHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNG EPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRP CHENCTQGCKGPELQDCLGQTLVLIGKTHLTSTGDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | ERBB3 v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) [ Homo sapiens ] |
Official Symbol | ERBB3 |
Synonyms | ERBB3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian); LCCS2, lethal congenital contracture syndrome 2; receptor tyrosine-protein kinase erbB-3; HER3; proto-oncogene-like protein c-ErbB-3; tyrosine kinase-type cell surface receptor HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3; MGC88033; |
Gene ID | 2065 |
mRNA Refseq | NM_001005915 |
Protein Refseq | NP_001005915 |
MIM | 190151 |
UniProt ID | P21860 |
Chromosome Location | 12q13 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Downregulation of ERRB2:ERBB3 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; |
Function | ATP binding; growth factor binding; growth factor binding; nucleotide binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein homodimerization activity; protein tyrosine kinase activator activity; NOT protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
ERBB3-197HAF647 | Recombinant Human ERBB3 Protein, DDDDK-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Erbb3-384M | Recombinant Mouse Erbb3 Protein, His-tagged | +Inquiry |
ERBB3-45H | Active Recombinant Human ERBB3 protein, Twin-Strep-tagged | +Inquiry |
ERBB3-1606C | Recombinant Cynomolgus/Rhesus macaque ERBB3 protein, His-tagged | +Inquiry |
ERBB3-237H | Recombinant Human ERBB3 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB3-939HCL | Recombinant Human ERBB3 cell lysate | +Inquiry |
ERBB3-1765MCL | Recombinant Mouse ERBB3 cell lysate | +Inquiry |
ERBB3-430HCL | Recombinant Human ERBB3 cell lysate | +Inquiry |
ERBB3-1415RCL | Recombinant Rat ERBB3 cell lysate | +Inquiry |
ERBB3-1721RCL | Recombinant Rhesus ERBB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERBB3 Products
Required fields are marked with *
My Review for All ERBB3 Products
Required fields are marked with *