Active Recombinant Human ERBB3 Fragment Protein (171 aa)
Cat.No. : | ERBB3-123E |
Product Overview : | Recombinant Human ERBB3 Fragment Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 171 |
Description : | ErbB3, also called Her3 (human epidermal growth factor receptor 3), is a type I membrane glycoprotein that is a member of the ErbB family of tyrosine kinase receptors. ErbB family members serve as receptors for the epidermal growth factor (EGF) family of growth factors. Among ErbB family members, ErbB3 is unique in that it contains a defective kinase domain. ErbB3 is expressed in keratinocytes, melanocytes, skeletal muscle cells, embryonic myoblasts and Schwann cells. Monomeric ErbB3 serves as a low affinity receptor for the heregulins (HRG). rhErbB3-f is a recombinant genetic engineering product which expressed in E. coli. RhErbB3-f can induce specific antibody production in vivo, hence to inhibit tumor cell growth. The product can be used to treat early, medium and advanced or post-operative breast cancer patients with over-expression of ErbB2. According to its mechanism of action, rhErbB3-f is classified into therapeutic cancer vaccine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active. Measured by its ability to postpone tumor emerge time of spontaneous breast cancer in FVB/N transgenic mice and inhibit the development of tumor, effectively inhibit the growth of in situ transplanted breast cancer in FVB/N transgenic mice. |
Molecular Mass : | Approximately 34 kDa, a single non-glycosylated fusion polypeptide chain, containing 171 amino acids (Ser20- Cys190) with N-terminus Thioredoxin Tag and His tag. |
AA Sequence : | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHPDLGTDDDDKAMADIGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVC |
Endotoxin : | Less than 1 EU/μg of rHuErbB3-f as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This liquid suspension is stable for several months at 0-4 centigrade, but should be kept at -20 centigrade for long term storage. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | A white, semitransparent suspension, the normal content of each vial is 1 mg of rhErbB3-f, 1mg aluminum hydroxide and small amount of arginine, sodium chloride, sodium phosphate, and potassium phosphate. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | ERBB3 v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) [ Homo sapiens ] |
Official Symbol | ERBB3 |
Synonyms | ERBB3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian); LCCS2, lethal congenital contracture syndrome 2; receptor tyrosine-protein kinase erbB-3; HER3; proto-oncogene-like protein c-ErbB-3; tyrosine kinase-type cell surface receptor HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3; MGC88033; |
Gene ID | 2065 |
mRNA Refseq | NM_001005915 |
Protein Refseq | NP_001005915 |
MIM | 190151 |
UniProt ID | P21860 |
◆ Recombinant Proteins | ||
ErbB3-275HF | Recombinant Human ERBB3 Protein, Fc-tagged, FITC conjugated | +Inquiry |
ERBB3-084H | Recombinant Human ERBB3 protein, His-Avi-tagged | +Inquiry |
ERBB3-238H | Recombinant Human ERBB3 Protein, Strep-tagged | +Inquiry |
ERBB3-207H | Recombinant Human ERBB3 Protein(Ser20-Thr643), His-Avi-tagged, FITC-Labeled | +Inquiry |
ERBB3-383H | Recombinant Human ERBB3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB3-430HCL | Recombinant Human ERBB3 cell lysate | +Inquiry |
ERBB3-1415RCL | Recombinant Rat ERBB3 cell lysate | +Inquiry |
ERBB3-1765MCL | Recombinant Mouse ERBB3 cell lysate | +Inquiry |
ERBB3-1721RCL | Recombinant Rhesus ERBB3 cell lysate | +Inquiry |
ERBB3-939HCL | Recombinant Human ERBB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERBB3 Products
Required fields are marked with *
My Review for All ERBB3 Products
Required fields are marked with *
0
Inquiry Basket