Active Recombinant Human ERBB4, His-tagged, Biotinylated

Cat.No. : ERBB4-622H
Product Overview : The recombinant human HER4 extracellular or ecto-domain (ECD) is expressed as a 637 amino acid protein consisting of Gln26-Pro651 region of HER4 and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 26-651 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : It was reported to inhibit the biological activity of Neuregulin-1 on MCF?7 human breast cancer cells.
Molecular Mass : Calculated molecular mass (kDa): 71.2; Estimated by SDS-PAGE under reducing condition (kDa): ~80
AA Sequence : QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPL ENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPS NLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCF ACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIK MCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTV REITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY HTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEF REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPC HPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPSTGHHHHHHHH
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name ERBB4 v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) [ Homo sapiens ]
Official Symbol ERBB4
Synonyms ERBB4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); v erb a avian erythroblastic leukemia viral oncogene homolog like 4; receptor tyrosine-protein kinase erbB-4; proto-oncogene-like protein c-ErbB-4; tyrosine kinase-type cell surface receptor HER4; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; HER4; p180erbB4; MGC138404;
Gene ID 2066
mRNA Refseq NM_001042599
Protein Refseq NP_001036064
MIM 600543
UniProt ID Q15303
Chromosome Location 2q33.3-q34
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Downregulation of ERBB4 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem;
Function ATP binding; epidermal growth factor receptor binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transcription regulatory region DNA binding; transmembrane receptor protein tyrosine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERBB4 Products

Required fields are marked with *

My Review for All ERBB4 Products

Required fields are marked with *

0
cart-icon