Active Recombinant Human ERBB4, His-tagged, Biotinylated
Cat.No. : | ERBB4-622H |
Product Overview : | The recombinant human HER4 extracellular or ecto-domain (ECD) is expressed as a 637 amino acid protein consisting of Gln26-Pro651 region of HER4 and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 26-651 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | It was reported to inhibit the biological activity of Neuregulin-1 on MCF?7 human breast cancer cells. |
Molecular Mass : | Calculated molecular mass (kDa): 71.2; Estimated by SDS-PAGE under reducing condition (kDa): ~80 |
AA Sequence : | QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPL ENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPS NLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCF ACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIK MCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTV REITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY HTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEF REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPC HPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPSTGHHHHHHHH |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | ERBB4 v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) [ Homo sapiens ] |
Official Symbol | ERBB4 |
Synonyms | ERBB4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); v erb a avian erythroblastic leukemia viral oncogene homolog like 4; receptor tyrosine-protein kinase erbB-4; proto-oncogene-like protein c-ErbB-4; tyrosine kinase-type cell surface receptor HER4; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; HER4; p180erbB4; MGC138404; |
Gene ID | 2066 |
mRNA Refseq | NM_001042599 |
Protein Refseq | NP_001036064 |
MIM | 600543 |
UniProt ID | Q15303 |
Chromosome Location | 2q33.3-q34 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Downregulation of ERBB4 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; |
Function | ATP binding; epidermal growth factor receptor binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transcription regulatory region DNA binding; transmembrane receptor protein tyrosine kinase activity; |
◆ Recombinant Proteins | ||
Erbb4-8720R | Active Recombinant Rat Erbb4 protein(Met1-Pro651), hFc-tagged | +Inquiry |
ERBB4-623H | Active Recombinant Human ERBB4, Fc-tagged, Biotinylated | +Inquiry |
ERBB4-240H | Recombinant Human ERBB4 Protein, Fc-tagged | +Inquiry |
Erbb4-7416M | Active Recombinant Mouse Erbb4 Protein, His tagged | +Inquiry |
ERBB4-7284H | Active Recombinant Human ERBB4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB4-1543HCL | Recombinant Human ERBB4 cell lysate | +Inquiry |
ERBB4-001HCL | Recombinant Human ERBB4 cell lysate | +Inquiry |
ERBB4-1417MCL | Recombinant Mouse ERBB4 cell lysate | +Inquiry |
ERBB4-895RCL | Recombinant Rat ERBB4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERBB4 Products
Required fields are marked with *
My Review for All ERBB4 Products
Required fields are marked with *