Active Recombinant Human Fas cell surface death receptor Protein, His tagged

Cat.No. : FAS-33H
Product Overview : Recombinant human FAS, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 26-173aa
Description : FAS, also known as tumor necrosis factor receptor superfamily member 6, belongs to the death receptor subfamily of the TNF receptor superfamily and is designated TNFRSF6. This protein plays a major role in controlling viral infections. While FAS is expressed on most cell types, its cognate ligand (FasL) is restricted to activated T, NK and dendritic cells. The upregulation of FasL and TRAIL on HCMV-infected dendritic cells promotes direct killing of activated T lymphocytes, an action that may preferentially delete HCMV-specific T cells. Moreover, the activation of FasL on HCMVinfected retinal pigment epithelial cells may subvertneutrophil function in HCMV retinitis.
Tag : C-His
Form : Liquid
Bio-activity : Measured by ability to inhibit FAS ligand-induced apoptosis assay using Jurkat human acute T cell leukemia cells in the presence of 2 ng/mL of human FAS ligand. The ED50 range ≤ 200 ng/mL.
Molecular Mass : 17.7 kDa (156aa)
AA Sequence : QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
Endotoxin : < 1 EU/μg by LAL
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
References : 1. Seirafian S., et al. (2014) J. Gen. Virol. 95(4):933-939.
2. Thurner EM., et al. (2014) Strahlenther Onkol 190(3):304-309.
Gene Name FAS Fas cell surface death receptor [ Homo sapiens (human) ]
Official Symbol FAS
Synonyms FAS; Fas (TNF receptor superfamily, member 6); APT1, FAS1, TNFRSF6, tumor necrosis factor receptor superfamily, member 6; tumor necrosis factor receptor superfamily member 6; APO 1; CD95; Fas AMA; FAS 827dupA; CD95 antigen; FASLG receptor; apoptosis antigen 1; Delta Fas/APO-1/CD95; APO-1 cell surface antigen; apoptosis-mediating surface antigen FAS; tumor necrosis factor receptor superfamily, member 6; APT1; FAS1; APO-1; FASTM; ALPS1A; TNFRSF6;
Gene ID 355
mRNA Refseq NM_000043
Protein Refseq NP_000034
MIM 134637
UniProt ID P25445

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAS Products

Required fields are marked with *

My Review for All FAS Products

Required fields are marked with *

0
cart-icon