Species : |
Human |
Source : |
Insect cells |
Tag : |
His |
Protein Length : |
26-173aa |
Description : |
FAS, also known as tumor necrosis factor receptor superfamily member 6, belongs to the death receptor subfamily of the TNF receptor superfamily and is designated TNFRSF6. This protein plays a major role in controlling viral infections. While FAS is expressed on most cell types, its cognate ligand (FasL) is restricted to activated T, NK and dendritic cells. The upregulation of FasL and TRAIL on HCMV-infected dendritic cells promotes direct killing of activated T lymphocytes, an action that may preferentially delete HCMV-specific T cells. Moreover, the activation of FasL on HCMVinfected retinal pigment epithelial cells may subvertneutrophil function in HCMV retinitis. |
Tag : |
C-His |
Form : |
Liquid |
Bio-activity : |
Measured by ability to inhibit FAS ligand-induced apoptosis assay using Jurkat human acute T cell leukemia cells in the presence of 2 ng/mL of human FAS ligand. The ED50 range ≤ 200 ng/mL. |
Molecular Mass : |
17.7 kDa (156aa) |
AA Sequence : |
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN |
Endotoxin : |
< 1 EU/μg by LAL |
Purity : |
> 95% by SDS-PAGE |
Applications : |
SDS-PAGE, Bioactivity |
Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Concentration : |
0.5 mg/mL (determined by absorbance at 280nm) |
References : |
1. Seirafian S., et al. (2014) J. Gen. Virol. 95(4):933-939. 2. Thurner EM., et al. (2014) Strahlenther Onkol 190(3):304-309. |