Active Recombinant Human FCGR2A (R167H) Protein (30-218aa), C-His-tagged
Cat.No. : | FCGR2A-17H |
Product Overview : | Recombinant human Fc gamma RIIA/CD32a (30-218aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
Availability | August 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 30-218 aa |
Description : | Fc gamma RIIA/CD32a, also known as Low affinity immunoglobulin gamma Fc region receptor II-a, are members of the Ig superfamily that function in the activation or inhibition of immune responses. Fc gamma RIIA is expressed on many immune cell types where inhibitory ITIM-bearing receptors may also be co-expressed and coengaged by specific ligands. Signaling through Fc gamma RIIA results in the initiation of inflammatory responses that can be modulated by signals from the inhibitory receptors. The strength of the signal is dependent on the ratio of expression of the activating and inhibitory receptors. Besides IC, Fc gamma RII A also binds C-reactive protein (CRP) Two allelic variants of Fc gamma RIIA that differ in their ability to ligate human IgG2 or CRP exist. The R167H allele has been found to have a protective effect against lupus nephritis. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Human IgG1 Fc. The ED50 range ≤5 μg/mL. |
Molecular Mass : | 21.6 kDa (195 aa) |
AA Sequence : | SADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Absorbance at 280 nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens (human) ] |
Official Symbol | FCGR2A |
Synonyms | FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032 |
Gene ID | 2212 |
mRNA Refseq | NM_001136219 |
Protein Refseq | NP_001129691 |
MIM | 146790 |
UniProt ID | P12318 |
◆ Recombinant Proteins | ||
FCGR2A-1134H | Active Recombinant Human FCGR2A protein, His-tagged | +Inquiry |
FCGR2A-041H | Recombinant Human FCGR2A Protein, ECD, Tag Free, Biotinylated | +Inquiry |
FCGR2A-1136H | Recombinant Human FCGR2A, His & AVI tagged | +Inquiry |
FCGR2A-519C | Recombinant Cynomolgus FCGR2A Protein, His-tagged | +Inquiry |
FCGR2A-301H | Recombinant Human FCGR2A Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FCGR2A-03H | Active Recombinant Human FCGR2A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
FCGR2A-001HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-678HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-1996HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR2A Products
Required fields are marked with *
My Review for All FCGR2A Products
Required fields are marked with *