Active Recombinant Human FGF1 Protein (140 aa)

Cat.No. : FGF1-404F
Product Overview : Recombinant human Fibroblast Growth Factor-acidic (rhFGF-acidic)produced in E. coli is a single non-glycosylated polypeptide chain containing 140 amino acids. A fully biologically active molecule, rhFGF-acidic has a molecular mass of 15.8 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 140
Description : Fibroblast Growth Factor-acidic (FGF-acidic), also known as FGF-1 and endothelial cell growth factor, is a member of the FGF family which currently contain 23 members. FGF acidic and basic, unlike the other members of the family, lack signal peptides and are apparently secreted by mechanisms other than the classical protein secretion pathway. FGF acidic has been detected in large amounts in the brain. Other cells known to express FGF acidic include hepatocytes, vascular smooth muscle cells, CNS neurons, skeletal muscle cells, fibroblasts, keratinocytes, endothelial cells, intestinal columnar epithelium cells and pituitary basophils and acidophils. As with other FGF's, FGF acidic exhibits considerable species cross reactivity. FGF acidic and FGF basic stimulate the proliferation of all cells of mesodermal origin, and many cells of neuroectodermal, ectodermal and endodermal origin.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.3 ng/mL, measured by a cell proliferation assay of 3T3 Cells, corresponding to a specific activity of >3.3 × 10^6 IU/mg in the presence of 10 μg/mL of heparin.
Molecular Mass : 15.8 kDa, observed by reducing SDS-PAGE.
AA Sequence : FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Fibroblast Growth Factor- acidic (rhFGF-acidic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-acidic should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name FGF1 fibroblast growth factor 1 [ Homo sapiens (human) ]
Official Symbol FGF1
Synonyms FGF1; fibroblast growth factor 1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; fibroblast growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1
Gene ID 2246
mRNA Refseq wwwcbilmihov/nuccore/NM_000800
Protein Refseq wwwcbilmihov/protein/NP_000791
MIM 131220
UniProt ID P05230

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF1 Products

Required fields are marked with *

My Review for All FGF1 Products

Required fields are marked with *

0
cart-icon