Active Recombinant Human FGF16 Protein (206 aa)

Cat.No. : FGF16-288F
Product Overview : Recombinant human FGF-16 produced in CHO cells is a polypeptide chain containing 206 amino acids. A fully biologically active molecule, rhFGF-16 has a molecular mass of 23 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Protein Length : 206
Description : Fibroblast Growth Factor-16 (FGF-16) is a heparin binding growth factor, a member of the FGF family. All FGF family members are heparin­binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The rat homolog is predominantly expressed in embryonic brown adipose tissue and has significant mitogenic activity, which suggests a role in proliferation of embryonic brown adipose tissue. FGF-16 is most similar to FGF-9 (73 % amino acid identity). The protein sequence of human FGF-16 displays 98.6% identity with rat FGF-16. Chimpanzee FGF-16 (207 amino acids), chicken FGF-16 (207 amino acids), and zebrafish FGF-16 (203 amino acids) show 100 %, 89.9 %, and 79.2 % total amino acid identity with human FGF-16.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured in a cell proliferation assay using 3T3 mouse fibroblast cell, The ED50 for this effect is < 20 ng/mL.
Molecular Mass : 23 kDa, observed by reducing SDS-PAGE.
AA Sequence : AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human Fibroblast Growth Factor-16 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Fibroblast Growth Factor-16 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name FGF16 fibroblast growth factor 16 [ Homo sapiens ]
Official Symbol FGF16
Synonyms FGF16; fibroblast growth factor 16; FGF-16;
Gene ID 8823
mRNA Refseq NM_003868
Protein Refseq NP_003859
MIM 300827
UniProt ID O43320

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF16 Products

Required fields are marked with *

My Review for All FGF16 Products

Required fields are marked with *

0
cart-icon
0
compare icon