Active Recombinant Human FGF2 Protein (145 aa)
Cat.No. : | FGF2-402F |
Product Overview : | Recombinant Human FGF-basic (145a.a.)produced in E. coli is a single non-glycosylated polypeptide chain containing 145 amino acids. A fully biologically active molecule, rhFGF-basic has a molecular mass of 16.4 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 145 |
Description : | Fibroblast Growth Factor-basic (FGF-basic), also known as FGF-2, is a pleiotropic cytokine and one of the prototypic members of the heparin-binding FGF family. Like other FGF family members, FGF-basic has the β trefoil structure. In vivo, FGF-basic is produced by a variety of cells, including cardiomycotes, fibroblasts, and vascular cells. FGF-basic regulates a variety of processes including cell proliferation, differentiation, survival, adhesion, motility, apoptosis, limb formation and wound healing. FGF-basic can be tumorigenic due to its role in angiogenesis and blood vessel remodeling. The angiogenic effects of FGF-basic can produce beneficial cardioprotection during acute heart injury. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.25 ng/mL, measured by the cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 4 × 10^6 units/mg |
Molecular Mass : | 16.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | ALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human FGF-basic (145a.a.) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human FGF-basic (145a.a.) should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | FGF2 fibroblast growth factor 2 (basic) [ Homo sapiens ] |
Official Symbol | FGF2 |
Synonyms | FGF2; fibroblast growth factor 2 (basic); FGFB; fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF; BFGF; FGF-2; HBGF-2; |
Gene ID | 2247 |
mRNA Refseq | NM_002006 |
Protein Refseq | NP_001997 |
MIM | 134920 |
UniProt ID | P09038 |
◆ Recombinant Proteins | ||
Fgf2-1489R | Recombinant Rat Fgf2 Protein, His-tagged | +Inquiry |
FGF2-1486H | Recombinant Human FGF2 Protein, His-tagged | +Inquiry |
FGF2-13H | Active Recombinant Human FGF2 Protein, Biotinylated | +Inquiry |
FGF2-754H | Active Recombinant Human FGF2 protein | +Inquiry |
FGF2-1182B | Recombinant Bovine Fibroblast Growth Factor 2 (basic) | +Inquiry |
◆ Native Proteins | ||
FGF2-046H | Active Recombinant Human FGF2 Protein | +Inquiry |
FGF2-066D | Recombinant Duck FGF Basic Protein, Tag Free | +Inquiry |
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-065C | Recombinant Chicken FGF Basic Protein, Tag Free | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *