Active Recombinant Human FGFR1, His-tagged, Biotinylated
Cat.No. : | FGFR1-605H |
Product Overview : | The recombinant human FGFR1 ECD protein is expressed as a 275 amino acid protein consisting of Arg22 - Glu285 region of FGFR1 (Uniprot accession #P11362 - isoform 15) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 6 potential N-linked glycosylation sites. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 22-285 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells. |
Molecular Mass : | Calculated molecular mass (kDa): 30.8; Estimated by SDS-PAGE under reducing condition (kDa): ~55 |
AA Sequence : | RPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNP TLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAG LPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFE DAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLESTGHHHHHHHH |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | FGFR1 fibroblast growth factor receptor 1 [ Homo sapiens ] |
Official Symbol | FGFR1 |
Synonyms | FGFR1; fibroblast growth factor receptor 1; FLT2, fms related tyrosine kinase 2 , KAL2; BFGFR; CD331; CEK; FLG; H2; H3; H4; H5; N SAM; Pfeiffer syndrome; FGFR1/PLAG1 fusion; proto-oncogene c-Fgr; FMS-like tyrosine kinase 2; hydroxyaryl-protein kinase; fms-related tyrosine kinase 2; heparin-binding growth factor receptor; basic fibroblast growth factor receptor 1; OGD; FLT2; KAL2; FGFBR; FLT-2; HBGFR; N-SAM; FGFR-1; bFGF-R-1; FLJ99988; |
Gene ID | 2260 |
mRNA Refseq | NM_001174063 |
Protein Refseq | NP_001167534 |
MIM | 136350 |
UniProt ID | P11362 |
Chromosome Location | 8p12 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; |
Function | ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; |
◆ Recombinant Proteins | ||
FGFR1-66C | Recombinant Rhesus FGFR1 protein, His-tagged | +Inquiry |
FGFR1-66RAF555 | Recombinant Monkey FGFR1 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
FGFR1-5375H | Recombinant Human FGFR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FGFR1-2056H | Recombinant Human FGFR1 Protein, His-tagged | +Inquiry |
FGFR1-55C | Recombinant Cynomolgus FGFR1, Fc tagged | +Inquiry |
◆ Native Proteins | ||
FGFR1-67H | Active Recombinant Human FGFR1 Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR1-476HCL | Recombinant Human FGFR1 cell lysate | +Inquiry |
FGFR1-2133MCL | Recombinant Mouse FGFR1 cell lysate | +Inquiry |
FGFR1-1171CCL | Recombinant Cynomolgus FGFR1 cell lysate | +Inquiry |
FGFR1-2765HCL | Recombinant Human FGFR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR1 Products
Required fields are marked with *
My Review for All FGFR1 Products
Required fields are marked with *