Active Recombinant Human FGFR1, His-tagged, Biotinylated

Cat.No. : FGFR1-605H
Product Overview : The recombinant human FGFR1 ECD protein is expressed as a 275 amino acid protein consisting of Arg22 - Glu285 region of FGFR1 (Uniprot accession #P11362 - isoform 15) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 6 potential N-linked glycosylation sites.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 22-285 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecular Mass : Calculated molecular mass (kDa): 30.8; Estimated by SDS-PAGE under reducing condition (kDa): ~55
AA Sequence : RPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNP TLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAG LPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFE DAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLESTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name FGFR1 fibroblast growth factor receptor 1 [ Homo sapiens ]
Official Symbol FGFR1
Synonyms FGFR1; fibroblast growth factor receptor 1; FLT2, fms related tyrosine kinase 2 , KAL2; BFGFR; CD331; CEK; FLG; H2; H3; H4; H5; N SAM; Pfeiffer syndrome; FGFR1/PLAG1 fusion; proto-oncogene c-Fgr; FMS-like tyrosine kinase 2; hydroxyaryl-protein kinase; fms-related tyrosine kinase 2; heparin-binding growth factor receptor; basic fibroblast growth factor receptor 1; OGD; FLT2; KAL2; FGFBR; FLT-2; HBGFR; N-SAM; FGFR-1; bFGF-R-1; FLJ99988;
Gene ID 2260
mRNA Refseq NM_001174063
Protein Refseq NP_001167534
MIM 136350
UniProt ID P11362
Chromosome Location 8p12
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem;
Function ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFR1 Products

Required fields are marked with *

My Review for All FGFR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon