Active Recombinant Human FGFR2, Fc-tagged, Biotinylated

Cat.No. : FGFR2-608H
Product Overview : The recombinant human FGFR2-Fc fusion protein is expressed as a 584 amino acid protein consisting of Arg22 - Glu377 region of FGFR2 (Uniprot accession #P21802 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 22-377 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.15 - 0.35 μg/ml
Molecular Mass : Calculated molecular mass (kDa): 65.1; Estimated by SDS-PAGE under reducing condition (kDa): 85-95
AA Sequence : RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIK GATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAV PAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHT YHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGV NTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLESTGTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name FGFR2 fibroblast growth factor receptor 2 [ Homo sapiens ]
Official Symbol FGFR2
Synonyms FGFR2; fibroblast growth factor receptor 2; bacteria expressed kinase , BEK, CFD1, craniofacial dysostosis 1 , Jackson Weiss syndrome , JWS, keratinocyte growth factor receptor , KGFR; CD332; CEK3; Crouzon syndrome; ECT1; K SAM; Pfeiffer syndrome; TK14; TK25; FGFR-2; FGF receptor; soluble FGFR4 variant 4; bacteria-expressed kinase; hydroxyaryl-protein kinase; keratinocyte growth factor receptor; BEK fibroblast growth factor receptor; protein tyrosine kinase, receptor like 14; BEK; JWS; CFD1; KGFR; BFR-1; K-SAM; FLJ98662;
Gene ID 2263
mRNA Refseq NM_000141
Protein Refseq NP_000132
MIM 176943
UniProt ID P21802
Chromosome Location 10q25.3-q26
Pathway Angiogenesis, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem;
Function ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFR2 Products

Required fields are marked with *

My Review for All FGFR2 Products

Required fields are marked with *

0
cart-icon