Active Recombinant Human FGFR2, Fc-tagged, Biotinylated
Cat.No. : | FGFR2-608H |
Product Overview : | The recombinant human FGFR2-Fc fusion protein is expressed as a 584 amino acid protein consisting of Arg22 - Glu377 region of FGFR2 (Uniprot accession #P21802 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-377 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.15 - 0.35 μg/ml |
Molecular Mass : | Calculated molecular mass (kDa): 65.1; Estimated by SDS-PAGE under reducing condition (kDa): 85-95 |
AA Sequence : | RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIK GATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAV PAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHT YHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGV NTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLESTGTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Conjugation : | Biotin |
Gene Name | FGFR2 fibroblast growth factor receptor 2 [ Homo sapiens ] |
Official Symbol | FGFR2 |
Synonyms | FGFR2; fibroblast growth factor receptor 2; bacteria expressed kinase , BEK, CFD1, craniofacial dysostosis 1 , Jackson Weiss syndrome , JWS, keratinocyte growth factor receptor , KGFR; CD332; CEK3; Crouzon syndrome; ECT1; K SAM; Pfeiffer syndrome; TK14; TK25; FGFR-2; FGF receptor; soluble FGFR4 variant 4; bacteria-expressed kinase; hydroxyaryl-protein kinase; keratinocyte growth factor receptor; BEK fibroblast growth factor receptor; protein tyrosine kinase, receptor like 14; BEK; JWS; CFD1; KGFR; BFR-1; K-SAM; FLJ98662; |
Gene ID | 2263 |
mRNA Refseq | NM_000141 |
Protein Refseq | NP_000132 |
MIM | 176943 |
UniProt ID | P21802 |
Chromosome Location | 10q25.3-q26 |
Pathway | Angiogenesis, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem; |
Function | ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; |
◆ Recombinant Proteins | ||
FGFR2-31452TH | Recombinant Human FGFR2, Fc-tagged | +Inquiry |
FGFR2-621HAF488 | Recombinant Human FGFR2 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
FGFR2-5418H | Recombinant Human Fibroblast Growth Factor Receptor 2, His-tagged | +Inquiry |
Fgfr2-1501R | Recombinant Rat Fgfr2 Protein, His-tagged | +Inquiry |
Fgfr2-502M | Recombinant Mouse Fgfr2, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGFR2-39H | Active Recombinant Human FGFR2 Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR2-001MCL | Recombinant Mouse FGFR2 cell lysate | +Inquiry |
FGFR2-2578HCL | Recombinant Human FGFR2 cell lysate | +Inquiry |
FGFR2-428HCL | Recombinant Human FGFR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR2 Products
Required fields are marked with *
My Review for All FGFR2 Products
Required fields are marked with *