Active Recombinant Human FGFR2, His-tagged, Biotinylated
| Cat.No. : | FGFR2-607H |
| Product Overview : | The recombinant human FGFR2 ECD protein is expressed as a 367 amino acid protein consisting of Arg22 - Glu377 region of FGFR2 (Uniprot accession #P21802 - isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 8 potential N-linked glycosylation sites. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | His |
| Protein Length : | 22-377 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) |
| Bio-activity : | Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells. |
| Molecular Mass : | Calculated molecular mass (kDa): 40.9; Estimated by SDS-PAGE under reducing condition (kDa): ~65 |
| AA Sequence : | RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIK GATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAV PAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHT YHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGV NTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLESTGHHHHHHHH |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | FGFR2 fibroblast growth factor receptor 2 [ Homo sapiens ] |
| Official Symbol | FGFR2 |
| Synonyms | FGFR2; fibroblast growth factor receptor 2; bacteria expressed kinase , BEK, CFD1, craniofacial dysostosis 1 , Jackson Weiss syndrome , JWS, keratinocyte growth factor receptor , KGFR; CD332; CEK3; Crouzon syndrome; ECT1; K SAM; Pfeiffer syndrome; TK14; TK25; FGFR-2; FGF receptor; soluble FGFR4 variant 4; bacteria-expressed kinase; hydroxyaryl-protein kinase; keratinocyte growth factor receptor; BEK fibroblast growth factor receptor; protein tyrosine kinase, receptor like 14; BEK; JWS; CFD1; KGFR; BFR-1; K-SAM; FLJ98662; |
| Gene ID | 2263 |
| mRNA Refseq | NM_000141 |
| Protein Refseq | NP_000132 |
| MIM | 176943 |
| UniProt ID | P21802 |
| Chromosome Location | 10q25.3-q26 |
| Pathway | Angiogenesis, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem; |
| Function | ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| FGFR2-777HAF488 | Recombinant Human FGFR2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| FGFR2-488H | Recombinant Human Fibroblast Growth Factor Receptor 2 | +Inquiry |
| Fgfr2-135M | Recombinant Mouse Fgfr2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGFR2-055H | Recombinant Human FGFR2 protein(IIIb), His-Avi-tagged | +Inquiry |
| FGFR2-186H | Recombinant Human FGFR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGFR2-2578HCL | Recombinant Human FGFR2 cell lysate | +Inquiry |
| FGFR2-001MCL | Recombinant Mouse FGFR2 cell lysate | +Inquiry |
| FGFR2-428HCL | Recombinant Human FGFR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR2 Products
Required fields are marked with *
My Review for All FGFR2 Products
Required fields are marked with *



