Active Recombinant Human FGFR3, Fc-tagged

Cat.No. : FGFR3-611H
Product Overview : The recombinant human FGFR3-Fc fusion protein is expressed as a 581 amino acid protein consisting of Glu23 - Gly375 region of FGFR3 (Uniprot accession #P22607 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 23-375 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity : Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.05 - 0.3 μg/ml
Molecular Mass : Calculated molecular mass (kDa): 63.7; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
AA Sequence : ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQV LNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAAN TVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLD VLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTD KELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGSTGTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name FGFR3 fibroblast growth factor receptor 3 [ Homo sapiens ]
Official Symbol FGFR3
Synonyms FGFR3; fibroblast growth factor receptor 3; ACH, achondroplasia, thanatophoric dwarfism; CD333; CEK2; JTK4; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; ACH; HSFGFR3EX;
Gene ID 2261
mRNA Refseq NM_000142
Protein Refseq NP_000133
MIM 134934
UniProt ID P22607
Chromosome Location 4p16.3
Pathway Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGFR ligand binding and activation, organism-specific biosystem;
Function ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; nucleotide binding; protein binding; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFR3 Products

Required fields are marked with *

My Review for All FGFR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon