Active Recombinant Human FGFR3, His-tagged
| Cat.No. : | FGFR3-612H |
| Product Overview : | The recombinant human FGFR3 ECD protein is expressed as a 364 amino acid protein consisting of Glu23 - Gly375 region of FGFR3 (Uniprot accession #P22607 - isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 8 potential N-linked glycosylation sites. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | His |
| Protein Length : | 23-375 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). |
| Bio-activity : | Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells. |
| Molecular Mass : | Calculated molecular mass (kDa): 39.5; Estimated by SDS-PAGE under reducing condition (kDa): 50-60 |
| AA Sequence : | ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQV LNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAAN TVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLD VLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTD KELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGSTGHHHHHHHH |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Gene Name | FGFR3 fibroblast growth factor receptor 3 [ Homo sapiens ] |
| Official Symbol | FGFR3 |
| Synonyms | FGFR3; fibroblast growth factor receptor 3; ACH, achondroplasia, thanatophoric dwarfism; CD333; CEK2; JTK4; FGFR-3; tyrosine kinase JTK4; hydroxyaryl-protein kinase; ACH; HSFGFR3EX; |
| Gene ID | 2261 |
| mRNA Refseq | NM_000142 |
| Protein Refseq | NP_000133 |
| MIM | 134934 |
| UniProt ID | P22607 |
| Chromosome Location | 4p16.3 |
| Pathway | Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGFR ligand binding and activation, organism-specific biosystem; |
| Function | ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; nucleotide binding; protein binding; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| FGFR3-6072HB | Recombinant Human FGFR3 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| FGFR3-779H | Active Recombinant Human FGFR3 protein, Fc-tagged | +Inquiry |
| FGFR3-751HAF488 | Recombinant Human FGFR3 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| FGFR3-4136H | Active Recombinant Human FGFR3 Protein, GST-tagged | +Inquiry |
| FGFR3-780HAF488 | Recombinant Human FGFR3 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGFR3-001CCL | Recombinant Cynomolgus FGFR3 cell lysate | +Inquiry |
| FGFR3-2596MCL | Recombinant Mouse FGFR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR3 Products
Required fields are marked with *
My Review for All FGFR3 Products
Required fields are marked with *




